Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4615520..4616318 Replicon chromosome
Accession NZ_CP119734
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag P1J22_RS23200 Protein ID WP_000854735.1
Coordinates 4615941..4616318 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag P1J22_RS23195 Protein ID WP_032153712.1
Coordinates 4615520..4615894 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS23160 (4611253) 4611253..4612137 + 885 WP_024166630.1 50S ribosome-binding GTPase -
P1J22_RS23165 (4612256) 4612256..4612933 + 678 WP_023155728.1 hypothetical protein -
P1J22_RS23170 (4612963) 4612963..4613172 + 210 WP_023155727.1 DUF905 family protein -
P1J22_RS23175 (4613263) 4613263..4614081 + 819 WP_001234693.1 DUF932 domain-containing protein -
P1J22_RS23180 (4614173) 4614173..4614658 + 486 WP_032153711.1 antirestriction protein -
P1J22_RS23185 (4614674) 4614674..4615150 + 477 WP_001186715.1 RadC family protein -
P1J22_RS23190 (4615219) 4615219..4615440 + 222 WP_000692345.1 DUF987 domain-containing protein -
P1J22_RS23195 (4615520) 4615520..4615894 + 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
P1J22_RS23200 (4615941) 4615941..4616318 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
P1J22_RS23205 (4616315) 4616315..4616806 + 492 WP_023155722.1 DUF5983 family protein -
P1J22_RS23210 (4616818) 4616818..4617015 + 198 WP_000839265.1 DUF957 domain-containing protein -
P1J22_RS23215 (4617100) 4617100..4617966 + 867 WP_032153714.1 DUF4942 domain-containing protein -
P1J22_RS23220 (4618038) 4618038..4618301 + 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
P1J22_RS23225 (4618298) 4618298..4618624 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1J22_RS23230 (4619088) 4619088..4620350 + 1263 WP_001218820.1 integrase arm-type DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 fimB / fimE / fimA / fimI / fimC / fimD / fimF / fimG / fimH / papG 4529226..4629070 99844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T274349 WP_000854735.1 NZ_CP119734:4615941-4616318 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT274349 WP_032153712.1 NZ_CP119734:4615520-4615894 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References