Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3278729..3279527 | Replicon | chromosome |
Accession | NZ_CP119734 | ||
Organism | Escherichia coli strain E92 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3L4GA68 |
Locus tag | P1J22_RS16595 | Protein ID | WP_000854898.1 |
Coordinates | 3278729..3279106 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | P1J22_RS16600 | Protein ID | WP_063082308.1 |
Coordinates | 3279153..3279527 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J22_RS16565 (3275390) | 3275390..3276094 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
P1J22_RS16570 (3276379) | 3276379..3276597 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
P1J22_RS16580 (3277088) | 3277088..3277930 | - | 843 | WP_063082311.1 | DUF4942 domain-containing protein | - |
P1J22_RS16585 (3278027) | 3278027..3278224 | - | 198 | WP_063082310.1 | DUF957 domain-containing protein | - |
P1J22_RS16590 (3278244) | 3278244..3278732 | - | 489 | WP_063082309.1 | DUF5983 family protein | - |
P1J22_RS16595 (3278729) | 3278729..3279106 | - | 378 | WP_000854898.1 | TA system toxin CbtA family protein | Toxin |
P1J22_RS16600 (3279153) | 3279153..3279527 | - | 375 | WP_063082308.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P1J22_RS16605 (3279607) | 3279607..3279828 | - | 222 | WP_000692352.1 | DUF987 domain-containing protein | - |
P1J22_RS16610 (3279915) | 3279915..3280391 | - | 477 | WP_001186768.1 | RadC family protein | - |
P1J22_RS16615 (3280407) | 3280407..3280892 | - | 486 | WP_032180519.1 | antirestriction protein | - |
P1J22_RS16620 (3280984) | 3280984..3281802 | - | 819 | WP_001234635.1 | DUF932 domain-containing protein | - |
P1J22_RS16625 (3281896) | 3281896..3282074 | + | 179 | Protein_3263 | hypothetical protein | - |
P1J22_RS16630 (3282213) | 3282213..3282626 | - | 414 | WP_000789536.1 | hypothetical protein | - |
P1J22_RS16635 (3282896) | 3282896..3283435 | - | 540 | WP_001104026.1 | DUF4339 domain-containing protein | - |
P1J22_RS16640 (3283561) | 3283561..3283914 | - | 354 | WP_249533150.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14050.07 Da Isoelectric Point: 8.5190
>T274347 WP_000854898.1 NZ_CP119734:c3279106-3278729 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13665.49 Da Isoelectric Point: 6.4653
>AT274347 WP_063082308.1 NZ_CP119734:c3279527-3279153 [Escherichia coli]
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|