Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3128716..3129370 | Replicon | chromosome |
Accession | NZ_CP119734 | ||
Organism | Escherichia coli strain E92 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | P1J22_RS15775 | Protein ID | WP_000244777.1 |
Coordinates | 3128716..3129123 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P1J22_RS15780 | Protein ID | WP_000354046.1 |
Coordinates | 3129104..3129370 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J22_RS15755 (3124673) | 3124673..3126406 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P1J22_RS15760 (3126412) | 3126412..3127122 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P1J22_RS15765 (3127147) | 3127147..3128043 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P1J22_RS15770 (3128155) | 3128155..3128676 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
P1J22_RS15775 (3128716) | 3128716..3129123 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
P1J22_RS15780 (3129104) | 3129104..3129370 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P1J22_RS15785 (3129613) | 3129613..3130593 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
P1J22_RS15790 (3130670) | 3130670..3131329 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
P1J22_RS15795 (3131493) | 3131493..3131804 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
P1J22_RS15800 (3131849) | 3131849..3133282 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
P1J22_RS15805 (3133339) | 3133339..3133470 | - | 132 | Protein_3100 | SDR family oxidoreductase | - |
P1J22_RS15810 (3133525) | 3133525..3133703 | - | 179 | Protein_3101 | helix-turn-helix domain-containing protein | - |
P1J22_RS15815 (3133711) | 3133711..3134082 | - | 372 | WP_244599612.1 | tail fiber assembly protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | nueA / msbA | 3091965..3275191 | 183226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T274346 WP_000244777.1 NZ_CP119734:c3129123-3128716 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |