Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2640414..2641039 | Replicon | chromosome |
Accession | NZ_CP119734 | ||
Organism | Escherichia coli strain E92 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P1J22_RS13350 | Protein ID | WP_000911330.1 |
Coordinates | 2640414..2640812 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | P1J22_RS13355 | Protein ID | WP_000450524.1 |
Coordinates | 2640812..2641039 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J22_RS13330 (2636292) | 2636292..2636492 | + | 201 | WP_000383836.1 | YpfN family protein | - |
P1J22_RS13335 (2636602) | 2636602..2637300 | - | 699 | WP_000679823.1 | esterase | - |
P1J22_RS13340 (2637374) | 2637374..2639389 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
P1J22_RS13345 (2639404) | 2639404..2640267 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
P1J22_RS13350 (2640414) | 2640414..2640812 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P1J22_RS13355 (2640812) | 2640812..2641039 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P1J22_RS13360 (2641193) | 2641193..2641906 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
P1J22_RS13365 (2642119) | 2642119..2643153 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
P1J22_RS13370 (2643170) | 2643170..2644048 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
P1J22_RS13375 (2644194) | 2644194..2644766 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
P1J22_RS13380 (2644766) | 2644766..2645236 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2632233..2641039 | 8806 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T274343 WP_000911330.1 NZ_CP119734:c2640812-2640414 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|