Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2099261..2100029 Replicon chromosome
Accession NZ_CP119734
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag P1J22_RS10760 Protein ID WP_000854814.1
Coordinates 2099655..2100029 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W4SUB1
Locus tag P1J22_RS10755 Protein ID WP_044863316.1
Coordinates 2099261..2099566 (+) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS10725 (2096102) 2096102..2096557 + 456 WP_000581504.1 IrmA family protein -
P1J22_RS10730 (2096636) 2096636..2096869 + 234 WP_001119729.1 DUF905 family protein -
P1J22_RS10735 (2096969) 2096969..2097787 + 819 WP_247779548.1 DUF932 domain-containing protein -
P1J22_RS10740 (2097869) 2097869..2098348 + 480 WP_000860087.1 antirestriction protein -
P1J22_RS10745 (2098364) 2098364..2098840 + 477 WP_001186726.1 RadC family protein -
P1J22_RS10750 (2098903) 2098903..2099124 + 222 WP_000692323.1 DUF987 domain-containing protein -
P1J22_RS10755 (2099261) 2099261..2099566 + 306 WP_044863316.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P1J22_RS10760 (2099655) 2099655..2100029 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P1J22_RS10765 (2100026) 2100026..2100220 + 195 WP_000988600.1 DUF5983 family protein -
P1J22_RS10770 (2100266) 2100266..2100346 + 81 Protein_2118 hypothetical protein -
P1J22_RS10775 (2100635) 2100635..2100763 - 129 Protein_2119 transposase domain-containing protein -
P1J22_RS10780 (2100883) 2100883..2101017 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
P1J22_RS10785 (2101118) 2101118..2101447 - 330 WP_000450409.1 DUF496 family protein -
P1J22_RS10790 (2101619) 2101619..2102677 - 1059 WP_001200891.1 FUSC family protein -
P1J22_RS10795 (2102875) 2102875..2103348 - 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
P1J22_RS10800 (2103467) 2103467..2104633 - 1167 WP_001464461.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T274341 WP_000854814.1 NZ_CP119734:2099655-2100029 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11250.00 Da        Isoelectric Point: 7.2621

>AT274341 WP_044863316.1 NZ_CP119734:2099261-2099566 [Escherichia coli]
MPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A3W4SUB1

References