Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1611821..1612347 | Replicon | chromosome |
| Accession | NZ_CP119734 | ||
| Organism | Escherichia coli strain E92 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | P1J22_RS08210 | Protein ID | WP_000323025.1 |
| Coordinates | 1611821..1612108 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | P1J22_RS08215 | Protein ID | WP_000534858.1 |
| Coordinates | 1612108..1612347 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J22_RS08160 (1606845) | 1606845..1607060 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| P1J22_RS08165 (1607280) | 1607280..1607450 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| P1J22_RS08170 (1607814) | 1607814..1608029 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| P1J22_RS08175 (1608330) | 1608330..1608542 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| P1J22_RS08180 (1608597) | 1608597..1608686 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| P1J22_RS08185 (1608964) | 1608964..1609716 | - | 753 | WP_001047135.1 | antitermination protein | - |
| P1J22_RS08190 (1609730) | 1609730..1610779 | - | 1050 | WP_028985484.1 | DUF968 domain-containing protein | - |
| P1J22_RS08195 (1610781) | 1610781..1611059 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| P1J22_RS08200 (1611126) | 1611126..1611377 | - | 252 | WP_000980994.1 | protein Rem | - |
| P1J22_RS08205 (1611594) | 1611594..1611749 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| P1J22_RS08210 (1611821) | 1611821..1612108 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| P1J22_RS08215 (1612108) | 1612108..1612347 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| P1J22_RS08220 (1612372) | 1612372..1612677 | + | 306 | WP_001326990.1 | protein YdfV | - |
| P1J22_RS08225 (1612880) | 1612880..1613212 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| P1J22_RS08230 (1613649) | 1613649..1613798 | - | 150 | WP_011443592.1 | protein YdfW | - |
| P1J22_RS08235 (1613919) | 1613919..1614941 | - | 1023 | Protein_1622 | ISNCY family transposase | - |
| P1J22_RS08240 (1615752) | 1615752..1616960 | + | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vgrG/tssI / rhs/PAAR / espR1 / espR1 / fimA / sodB | 1303298..1725995 | 422697 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T274336 WP_000323025.1 NZ_CP119734:c1612108-1611821 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|