Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 49334..50169 Replicon chromosome
Accession NZ_CP119734
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2I6F8K9
Locus tag P1J22_RS00255 Protein ID WP_063102707.1
Coordinates 49334..49711 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2I6F7Z1
Locus tag P1J22_RS00260 Protein ID WP_063102708.1
Coordinates 49801..50169 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS00225 (44699) 44699..45622 - 924 WP_000535960.1 carboxylate/amino acid/amine transporter -
P1J22_RS00230 (45733) 45733..46917 - 1185 WP_001172877.1 sugar efflux transporter -
P1J22_RS00235 (47347) 47347..47475 - 129 Protein_46 RhuM family protein -
P1J22_RS00240 (47713) 47713..48555 - 843 WP_063102704.1 DUF4942 domain-containing protein -
P1J22_RS00245 (48640) 48640..48837 - 198 WP_063102705.1 DUF957 domain-containing protein -
P1J22_RS00250 (48849) 48849..49337 - 489 WP_063102706.1 DUF5983 family protein -
P1J22_RS00255 (49334) 49334..49711 - 378 WP_063102707.1 TA system toxin CbtA family protein Toxin
P1J22_RS00260 (49801) 49801..50169 - 369 WP_063102708.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P1J22_RS00265 (50180) 50180..50332 - 153 WP_169002405.1 hypothetical protein -
P1J22_RS00270 (50332) 50332..50553 - 222 WP_063102709.1 DUF987 domain-containing protein -
P1J22_RS00275 (50616) 50616..51092 - 477 WP_063116755.1 RadC family protein -
P1J22_RS00280 (51108) 51108..51590 - 483 WP_063102711.1 antirestriction protein -
P1J22_RS00285 (51681) 51681..52499 - 819 WP_063102712.1 DUF932 domain-containing protein -
P1J22_RS00290 (52589) 52589..52822 - 234 WP_063102713.1 DUF905 family protein -
P1J22_RS00295 (52828) 52828..53505 - 678 WP_063116756.1 hypothetical protein -
P1J22_RS00300 (53624) 53624..54508 - 885 WP_063102632.1 YfjP family GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14077.05 Da        Isoelectric Point: 7.9086

>T274330 WP_063102707.1 NZ_CP119734:c49711-49334 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRNNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.26 Da        Isoelectric Point: 6.3147

>AT274330 WP_063102708.1 NZ_CP119734:c50169-49801 [Escherichia coli]
VSDTFSGTTHPDDNNSRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I6F8K9

Antitoxin

Source ID Structure
AlphaFold DB A0A2I6F7Z1

References