Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49334..50169 | Replicon | chromosome |
| Accession | NZ_CP119734 | ||
| Organism | Escherichia coli strain E92 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2I6F8K9 |
| Locus tag | P1J22_RS00255 | Protein ID | WP_063102707.1 |
| Coordinates | 49334..49711 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2I6F7Z1 |
| Locus tag | P1J22_RS00260 | Protein ID | WP_063102708.1 |
| Coordinates | 49801..50169 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J22_RS00225 (44699) | 44699..45622 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| P1J22_RS00230 (45733) | 45733..46917 | - | 1185 | WP_001172877.1 | sugar efflux transporter | - |
| P1J22_RS00235 (47347) | 47347..47475 | - | 129 | Protein_46 | RhuM family protein | - |
| P1J22_RS00240 (47713) | 47713..48555 | - | 843 | WP_063102704.1 | DUF4942 domain-containing protein | - |
| P1J22_RS00245 (48640) | 48640..48837 | - | 198 | WP_063102705.1 | DUF957 domain-containing protein | - |
| P1J22_RS00250 (48849) | 48849..49337 | - | 489 | WP_063102706.1 | DUF5983 family protein | - |
| P1J22_RS00255 (49334) | 49334..49711 | - | 378 | WP_063102707.1 | TA system toxin CbtA family protein | Toxin |
| P1J22_RS00260 (49801) | 49801..50169 | - | 369 | WP_063102708.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P1J22_RS00265 (50180) | 50180..50332 | - | 153 | WP_169002405.1 | hypothetical protein | - |
| P1J22_RS00270 (50332) | 50332..50553 | - | 222 | WP_063102709.1 | DUF987 domain-containing protein | - |
| P1J22_RS00275 (50616) | 50616..51092 | - | 477 | WP_063116755.1 | RadC family protein | - |
| P1J22_RS00280 (51108) | 51108..51590 | - | 483 | WP_063102711.1 | antirestriction protein | - |
| P1J22_RS00285 (51681) | 51681..52499 | - | 819 | WP_063102712.1 | DUF932 domain-containing protein | - |
| P1J22_RS00290 (52589) | 52589..52822 | - | 234 | WP_063102713.1 | DUF905 family protein | - |
| P1J22_RS00295 (52828) | 52828..53505 | - | 678 | WP_063116756.1 | hypothetical protein | - |
| P1J22_RS00300 (53624) | 53624..54508 | - | 885 | WP_063102632.1 | YfjP family GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14077.05 Da Isoelectric Point: 7.9086
>T274330 WP_063102707.1 NZ_CP119734:c49711-49334 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRNNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRNNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I6F8K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I6F7Z1 |