Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 20726..21285 Replicon plasmid pE32-3
Accession NZ_CP119733
Organism Escherichia coli strain E32

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P1J21_RS26235 Protein ID WP_000421257.1
Coordinates 21010..21285 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0H2XL20
Locus tag P1J21_RS26230 Protein ID WP_012006537.1
Coordinates 20726..21010 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J21_RS26205 (P1J21_26205) 16484..17245 - 762 WP_000020503.1 ABC transporter ATP-binding protein -
P1J21_RS26210 (P1J21_26210) 17245..18282 - 1038 WP_032353476.1 iron ABC transporter permease -
P1J21_RS26215 (P1J21_26215) 18282..19280 - 999 WP_032353474.1 ABC transporter substrate-binding protein -
P1J21_RS26220 (P1J21_26220) 19430..19588 - 159 Protein_25 integrase core domain-containing protein -
P1J21_RS26225 (P1J21_26225) 19635..20225 - 591 WP_000086536.1 recombinase family protein -
P1J21_RS26230 (P1J21_26230) 20726..21010 + 285 WP_012006537.1 ribbon-helix-helix domain-containing protein Antitoxin
P1J21_RS26235 (P1J21_26235) 21010..21285 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J21_RS26240 (P1J21_26240) 21424..22961 - 1538 Protein_29 IS66-like element ISEc8 family transposase -
P1J21_RS26245 (P1J21_26245) 23011..23358 - 348 WP_000612591.1 IS66 family insertion sequence element accessory protein TnpB -
P1J21_RS26250 (P1J21_26250) 23355..23735 - 381 WP_001171523.1 transposase -
P1J21_RS26255 (P1J21_26255) 23843..24569 + 727 Protein_32 IS256-like element IS1414 family transposase -
P1J21_RS26260 (P1J21_26260) 24623..25981 - 1359 WP_032353707.1 esterase-like activity of phytase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129739 129739
- inside IScluster/Tn - - 5688..49340 43652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T274328 WP_000421257.1 NZ_CP119733:21010-21285 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10501.96 Da        Isoelectric Point: 6.4632

>AT274328 WP_012006537.1 NZ_CP119733:20726-21010 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVKSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2XL20

References