Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4181..4706 | Replicon | plasmid pE32-3 |
| Accession | NZ_CP119733 | ||
| Organism | Escherichia coli strain E32 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | P1J21_RS26125 | Protein ID | WP_001159871.1 |
| Coordinates | 4181..4486 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | P1J21_RS26130 | Protein ID | WP_000813630.1 |
| Coordinates | 4488..4706 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J21_RS26100 (P1J21_26100) | 531..1193 | + | 663 | Protein_1 | colicin-like pore-forming protein | - |
| P1J21_RS26105 (P1J21_26105) | 1211..1738 | - | 528 | WP_032353548.1 | colicin B immunity protein | - |
| P1J21_RS26110 (P1J21_26110) | 1980..2795 | + | 816 | WP_032494159.1 | lipid II-degrading bacteriocin colicin M | - |
| P1J21_RS26115 (P1J21_26115) | 2845..3198 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
| P1J21_RS26120 (P1J21_26120) | 3371..4180 | - | 810 | WP_045145707.1 | site-specific integrase | - |
| P1J21_RS26125 (P1J21_26125) | 4181..4486 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| P1J21_RS26130 (P1J21_26130) | 4488..4706 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| P1J21_RS26135 (P1J21_26135) | 5688..5819 | + | 132 | Protein_8 | transposase | - |
| P1J21_RS26140 (P1J21_26140) | 5867..6052 | + | 186 | WP_032353630.1 | hypothetical protein | - |
| P1J21_RS26145 (P1J21_26145) | 6084..6536 | - | 453 | WP_032353631.1 | acyltransferase | - |
| P1J21_RS26155 (P1J21_26155) | 8702..9118 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| P1J21_RS26160 (P1J21_26160) | 9115..9345 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..129739 | 129739 | |
| - | inside | IScluster/Tn | - | - | 5688..49340 | 43652 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T274326 WP_001159871.1 NZ_CP119733:c4486-4181 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |