Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4181..4706 Replicon plasmid pE32-3
Accession NZ_CP119733
Organism Escherichia coli strain E32

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag P1J21_RS26125 Protein ID WP_001159871.1
Coordinates 4181..4486 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag P1J21_RS26130 Protein ID WP_000813630.1
Coordinates 4488..4706 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J21_RS26100 (P1J21_26100) 531..1193 + 663 Protein_1 colicin-like pore-forming protein -
P1J21_RS26105 (P1J21_26105) 1211..1738 - 528 WP_032353548.1 colicin B immunity protein -
P1J21_RS26110 (P1J21_26110) 1980..2795 + 816 WP_032494159.1 lipid II-degrading bacteriocin colicin M -
P1J21_RS26115 (P1J21_26115) 2845..3198 - 354 WP_000864812.1 colicin M immunity protein -
P1J21_RS26120 (P1J21_26120) 3371..4180 - 810 WP_045145707.1 site-specific integrase -
P1J21_RS26125 (P1J21_26125) 4181..4486 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
P1J21_RS26130 (P1J21_26130) 4488..4706 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P1J21_RS26135 (P1J21_26135) 5688..5819 + 132 Protein_8 transposase -
P1J21_RS26140 (P1J21_26140) 5867..6052 + 186 WP_032353630.1 hypothetical protein -
P1J21_RS26145 (P1J21_26145) 6084..6536 - 453 WP_032353631.1 acyltransferase -
P1J21_RS26155 (P1J21_26155) 8702..9118 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
P1J21_RS26160 (P1J21_26160) 9115..9345 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129739 129739
- inside IScluster/Tn - - 5688..49340 43652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T274326 WP_001159871.1 NZ_CP119733:c4486-4181 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT274326 WP_000813630.1 NZ_CP119733:c4706-4488 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References