Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3659080..3659917 | Replicon | chromosome |
Accession | NZ_CP119730 | ||
Organism | Escherichia coli strain E32 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | P1J21_RS17865 | Protein ID | WP_000227784.1 |
Coordinates | 3659375..3659917 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | P1J21_RS17860 | Protein ID | WP_001297137.1 |
Coordinates | 3659080..3659391 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J21_RS17835 (3654100) | 3654100..3655047 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
P1J21_RS17840 (3655069) | 3655069..3657060 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
P1J21_RS17845 (3657050) | 3657050..3657664 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P1J21_RS17850 (3657664) | 3657664..3657993 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P1J21_RS17855 (3658005) | 3658005..3658895 | + | 891 | WP_000971336.1 | heme o synthase | - |
P1J21_RS17860 (3659080) | 3659080..3659391 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
P1J21_RS17865 (3659375) | 3659375..3659917 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
P1J21_RS17875 (3660860) | 3660860..3661684 | - | 825 | Protein_3497 | tetratricopeptide repeat protein | - |
P1J21_RS17880 (3662092) | 3662092..3663456 | + | 1365 | WP_001000974.1 | MFS transporter | - |
P1J21_RS17885 (3663690) | 3663690..3664670 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T274314 WP_000227784.1 NZ_CP119730:3659375-3659917 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|