Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2613303..2613941 | Replicon | chromosome |
Accession | NZ_CP119730 | ||
Organism | Escherichia coli strain E32 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P1J21_RS12755 | Protein ID | WP_000813794.1 |
Coordinates | 2613765..2613941 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P1J21_RS12750 | Protein ID | WP_001270286.1 |
Coordinates | 2613303..2613719 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J21_RS12730 (2608455) | 2608455..2609396 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
P1J21_RS12735 (2609397) | 2609397..2610410 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
P1J21_RS12740 (2610428) | 2610428..2611573 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
P1J21_RS12745 (2611818) | 2611818..2613224 | - | 1407 | WP_000760592.1 | PLP-dependent aminotransferase family protein | - |
P1J21_RS12750 (2613303) | 2613303..2613719 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P1J21_RS12755 (2613765) | 2613765..2613941 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P1J21_RS12760 (2614163) | 2614163..2614393 | + | 231 | WP_000494244.1 | YncJ family protein | - |
P1J21_RS12765 (2614485) | 2614485..2616446 | - | 1962 | WP_001593323.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P1J21_RS12770 (2616519) | 2616519..2617055 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
P1J21_RS12775 (2617147) | 2617147..2618322 | + | 1176 | WP_001236215.1 | BenE family transporter YdcO | - |
P1J21_RS12780 (2618362) | 2618362..2618676 | - | 315 | Protein_2502 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T274312 WP_000813794.1 NZ_CP119730:c2613941-2613765 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT274312 WP_001270286.1 NZ_CP119730:c2613719-2613303 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|