Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 101458..101983 | Replicon | plasmid pE16-3 |
Accession | NZ_CP119729 | ||
Organism | Escherichia coli strain E16 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | P1J20_RS26625 | Protein ID | WP_001159871.1 |
Coordinates | 101678..101983 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | P1J20_RS26620 | Protein ID | WP_000813630.1 |
Coordinates | 101458..101676 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J20_RS26590 (P1J20_26590) | 96819..97049 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P1J20_RS26595 (P1J20_26595) | 97046..97462 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
P1J20_RS26600 (P1J20_26600) | 98024..99237 | + | 1214 | WP_219795283.1 | IS3 family transposase | - |
P1J20_RS26605 (P1J20_26605) | 99628..100080 | + | 453 | WP_032353631.1 | acyltransferase | - |
P1J20_RS26610 (P1J20_26610) | 100112..100297 | - | 186 | WP_032353630.1 | hypothetical protein | - |
P1J20_RS26615 (P1J20_26615) | 100345..100476 | - | 132 | Protein_106 | transposase | - |
P1J20_RS26620 (P1J20_26620) | 101458..101676 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
P1J20_RS26625 (P1J20_26625) | 101678..101983 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
P1J20_RS26630 (P1J20_26630) | 101984..102793 | + | 810 | WP_045145707.1 | site-specific integrase | - |
P1J20_RS26635 (P1J20_26635) | 102966..103319 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
P1J20_RS26640 (P1J20_26640) | 103369..104184 | - | 816 | WP_032494159.1 | lipid II-degrading bacteriocin colicin M | - |
P1J20_RS26645 (P1J20_26645) | 104426..104953 | + | 528 | WP_032353548.1 | colicin B immunity protein | - |
P1J20_RS26650 (P1J20_26650) | 104971..105633 | - | 663 | Protein_113 | colicin-like pore-forming protein | - |
P1J20_RS26655 (P1J20_26655) | 105691..106388 | + | 698 | WP_249940384.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..129738 | 129738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T274299 WP_001159871.1 NZ_CP119729:101678-101983 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |