Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 96819..97462 Replicon plasmid pE16-3
Accession NZ_CP119729
Organism Escherichia coli strain E16

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P1J20_RS26595 Protein ID WP_001034046.1
Coordinates 97046..97462 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P1J20_RS26590 Protein ID WP_001261278.1
Coordinates 96819..97049 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J20_RS26565 (P1J20_26565) 91946..92140 + 195 Protein_96 helix-turn-helix domain-containing protein -
P1J20_RS26570 (P1J20_26570) 92400..93263 - 864 WP_021534910.1 endonuclease/exonuclease/phosphatase family protein -
P1J20_RS26580 (P1J20_26580) 94373..94762 - 390 WP_045146805.1 cytochrome b562 -
P1J20_RS26585 (P1J20_26585) 95147..96634 - 1488 Protein_100 IncI1-type relaxase NikB -
P1J20_RS26590 (P1J20_26590) 96819..97049 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P1J20_RS26595 (P1J20_26595) 97046..97462 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P1J20_RS26600 (P1J20_26600) 98024..99237 + 1214 WP_219795283.1 IS3 family transposase -
P1J20_RS26605 (P1J20_26605) 99628..100080 + 453 WP_032353631.1 acyltransferase -
P1J20_RS26610 (P1J20_26610) 100112..100297 - 186 WP_032353630.1 hypothetical protein -
P1J20_RS26615 (P1J20_26615) 100345..100476 - 132 Protein_106 transposase -
P1J20_RS26620 (P1J20_26620) 101458..101676 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
P1J20_RS26625 (P1J20_26625) 101678..101983 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..129738 129738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T274298 WP_001034046.1 NZ_CP119729:97046-97462 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT274298 WP_001261278.1 NZ_CP119729:96819-97049 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References