Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 84879..85438 Replicon plasmid pE16-3
Accession NZ_CP119729
Organism Escherichia coli strain E16

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P1J20_RS26515 Protein ID WP_000421257.1
Coordinates 84879..85154 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0H2XL20
Locus tag P1J20_RS26520 Protein ID WP_012006537.1
Coordinates 85154..85438 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J20_RS26490 (P1J20_26490) 80183..81541 + 1359 WP_032353707.1 esterase-like activity of phytase family protein -
P1J20_RS26495 (P1J20_26495) 81595..82321 - 727 Protein_82 IS256-like element IS1414 family transposase -
P1J20_RS26500 (P1J20_26500) 82429..82809 + 381 WP_001171523.1 transposase -
P1J20_RS26505 (P1J20_26505) 82806..83153 + 348 WP_000612591.1 IS66 family insertion sequence element accessory protein TnpB -
P1J20_RS26510 (P1J20_26510) 83203..84740 + 1538 Protein_85 IS66-like element ISEc8 family transposase -
P1J20_RS26515 (P1J20_26515) 84879..85154 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J20_RS26520 (P1J20_26520) 85154..85438 - 285 WP_012006537.1 ribbon-helix-helix domain-containing protein Antitoxin
P1J20_RS26525 (P1J20_26525) 85939..86529 + 591 WP_000086536.1 recombinase family protein -
P1J20_RS26530 (P1J20_26530) 86576..86734 + 159 Protein_89 integrase core domain-containing protein -
P1J20_RS26535 (P1J20_26535) 86884..87882 + 999 WP_032353474.1 ABC transporter substrate-binding protein -
P1J20_RS26540 (P1J20_26540) 87882..88919 + 1038 WP_032353476.1 iron ABC transporter permease -
P1J20_RS26545 (P1J20_26545) 88919..89680 + 762 WP_000020503.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..129738 129738
- inside IScluster/Tn - - 56824..86529 29705


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T274297 WP_000421257.1 NZ_CP119729:c85154-84879 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10501.96 Da        Isoelectric Point: 6.4632

>AT274297 WP_012006537.1 NZ_CP119729:c85438-85154 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVKSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2XL20

References