Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1098744..1099342 | Replicon | chromosome |
Accession | NZ_CP119676 | ||
Organism | Varunaivibrio sulfuroxidans strain TC8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | P3M64_RS05120 | Protein ID | WP_132940169.1 |
Coordinates | 1098744..1098932 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P3M64_RS05125 | Protein ID | WP_132940168.1 |
Coordinates | 1098938..1099342 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3M64_RS05085 (P3M64_05085) | 1094065..1095204 | + | 1140 | WP_132940198.1 | IS30 family transposase | - |
P3M64_RS05090 (P3M64_05090) | 1095301..1096455 | + | 1155 | WP_132940175.1 | plasmid replication protein RepC | - |
P3M64_RS05095 (P3M64_05095) | 1096820..1097248 | + | 429 | WP_132940173.1 | type II toxin-antitoxin system HicB family antitoxin | - |
P3M64_RS05100 (P3M64_05100) | 1097316..1097552 | - | 237 | WP_132940172.1 | hypothetical protein | - |
P3M64_RS05105 (P3M64_05105) | 1097594..1097857 | + | 264 | WP_165886415.1 | replication initiation protein RepC | - |
P3M64_RS05110 (P3M64_05110) | 1097989..1098267 | + | 279 | WP_243644894.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P3M64_RS05115 (P3M64_05115) | 1098267..1098590 | + | 324 | WP_132940170.1 | HigA family addiction module antitoxin | - |
P3M64_RS05120 (P3M64_05120) | 1098744..1098932 | + | 189 | WP_132940169.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P3M64_RS05125 (P3M64_05125) | 1098938..1099342 | + | 405 | WP_132940168.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P3M64_RS05130 (P3M64_05130) | 1099436..1099728 | + | 293 | Protein_1008 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P3M64_RS05135 (P3M64_05135) | 1099730..1100050 | + | 321 | WP_132940167.1 | putative addiction module antidote protein | - |
P3M64_RS05140 (P3M64_05140) | 1100028..1100264 | - | 237 | WP_132940166.1 | hypothetical protein | - |
P3M64_RS05145 (P3M64_05145) | 1100306..1100584 | + | 279 | WP_165886414.1 | replication initiation protein RepC | - |
P3M64_RS05150 (P3M64_05150) | 1100611..1100892 | + | 282 | WP_132940164.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P3M64_RS05155 (P3M64_05155) | 1100908..1101189 | + | 282 | WP_132940163.1 | HigA family addiction module antitoxin | - |
P3M64_RS05160 (P3M64_05160) | 1101233..1101508 | + | 276 | WP_132940177.1 | BrnT family toxin | - |
P3M64_RS05165 (P3M64_05165) | 1101468..1101758 | + | 291 | WP_132940162.1 | helix-turn-helix domain-containing protein | - |
P3M64_RS05170 (P3M64_05170) | 1101782..1102996 | - | 1215 | WP_132940161.1 | recombinase family protein | - |
P3M64_RS05175 (P3M64_05175) | 1102929..1103183 | - | 255 | WP_243644900.1 | BRO family protein | - |
P3M64_RS05180 (P3M64_05180) | 1103334..1103558 | + | 225 | WP_132940160.1 | hypothetical protein | - |
P3M64_RS05185 (P3M64_05185) | 1103743..1104186 | - | 444 | WP_132940159.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1094065..1119589 | 25524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7164.38 Da Isoelectric Point: 11.6831
>T274266 WP_132940169.1 NZ_CP119676:1098744-1098932 [Varunaivibrio sulfuroxidans]
MNSKEIIKRLESDGWFEVQRRGSHVQFKHAAKKGRVTVPHPKRDLPIGTLRSIEKQAGVKMR
MNSKEIIKRLESDGWFEVQRRGSHVQFKHAAKKGRVTVPHPKRDLPIGTLRSIEKQAGVKMR
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14459.46 Da Isoelectric Point: 4.8165
>AT274266 WP_132940168.1 NZ_CP119676:1098938-1099342 [Varunaivibrio sulfuroxidans]
MAHYIALLRKEEESDFAVEFPDFPGCVTAGTTLDEAKDMAVEALALHIEGIREDGGGLPTPSRLETIMADPHNVGAVAFL
VDAPAVKEKAVRVNFTILESVLRRVDAHAKAQHLTRSAFLAEAAIKAISDNEHV
MAHYIALLRKEEESDFAVEFPDFPGCVTAGTTLDEAKDMAVEALALHIEGIREDGGGLPTPSRLETIMADPHNVGAVAFL
VDAPAVKEKAVRVNFTILESVLRRVDAHAKAQHLTRSAFLAEAAIKAISDNEHV
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|