Detailed information of TA system TA274266

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicA-HicB
• Location: 1098744..1099342
• Replicon: chromosome
• Accession: NZ_CP119676
• Organism: Varunaivibrio sulfuroxidans strain TC8

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: -
• Locus tag: P3M64_RS05120
• Protein ID: WP_132940169.1
• Coordinates: 1098744..1098932 (+)
• Length: 63 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: -
• Locus tag: P3M64_RS05125
• Protein ID: WP_132940168.1
• Coordinates: 1098938..1099342 (+)
• Length: 135 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P3M64_RS05085 (P3M64_05085)	1094065..1095204	+	1140	WP_132940198.1	IS30 family transposase	-
P3M64_RS05090 (P3M64_05090)	1095301..1096455	+	1155	WP_132940175.1	plasmid replication protein RepC	-
P3M64_RS05095 (P3M64_05095)	1096820..1097248	+	429	WP_132940173.1	type II toxin-antitoxin system HicB family antitoxin	-
P3M64_RS05100 (P3M64_05100)	1097316..1097552	-	237	WP_132940172.1	hypothetical protein	-
P3M64_RS05105 (P3M64_05105)	1097594..1097857	+	264	WP_165886415.1	replication initiation protein RepC	-
P3M64_RS05110 (P3M64_05110)	1097989..1098267	+	279	WP_243644894.1	type II toxin-antitoxin system RelE/ParE family toxin	-
P3M64_RS05115 (P3M64_05115)	1098267..1098590	+	324	WP_132940170.1	HigA family addiction module antitoxin	-
P3M64_RS05120 (P3M64_05120)	1098744..1098932	+	189	WP_132940169.1	type II toxin-antitoxin system HicA family toxin	Toxin
P3M64_RS05125 (P3M64_05125)	1098938..1099342	+	405	WP_132940168.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
P3M64_RS05130 (P3M64_05130)	1099436..1099728	+	293	Protein_1008	type II toxin-antitoxin system RelE/ParE family toxin	-
P3M64_RS05135 (P3M64_05135)	1099730..1100050	+	321	WP_132940167.1	putative addiction module antidote protein	-
P3M64_RS05140 (P3M64_05140)	1100028..1100264	-	237	WP_132940166.1	hypothetical protein	-
P3M64_RS05145 (P3M64_05145)	1100306..1100584	+	279	WP_165886414.1	replication initiation protein RepC	-
P3M64_RS05150 (P3M64_05150)	1100611..1100892	+	282	WP_132940164.1	type II toxin-antitoxin system RelE/ParE family toxin	-
P3M64_RS05155 (P3M64_05155)	1100908..1101189	+	282	WP_132940163.1	HigA family addiction module antitoxin	-
P3M64_RS05160 (P3M64_05160)	1101233..1101508	+	276	WP_132940177.1	BrnT family toxin	-
P3M64_RS05165 (P3M64_05165)	1101468..1101758	+	291	WP_132940162.1	helix-turn-helix domain-containing protein	-
P3M64_RS05170 (P3M64_05170)	1101782..1102996	-	1215	WP_132940161.1	recombinase family protein	-
P3M64_RS05175 (P3M64_05175)	1102929..1103183	-	255	WP_243644900.1	BRO family protein	-
P3M64_RS05180 (P3M64_05180)	1103334..1103558	+	225	WP_132940160.1	hypothetical protein	-
P3M64_RS05185 (P3M64_05185)	1103743..1104186	-	444	WP_132940159.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1094065..1119589	25524

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (4-59)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (4-124)

Sequences

Toxin

Protein

• Length: 63 a.a.
• Molecular weight: 7164.38 Da
• Isoelectric Point: 11.6831

>T274266 WP_132940169.1 NZ_CP119676:1098744-1098932 [Varunaivibrio sulfuroxidans]
MNSKEIIKRLESDGWFEVQRRGSHVQFKHAAKKGRVTVPHPKRDLPIGTLRSIEKQAGVKMR

Nucleotide

• Length: 189 bp

Antitoxin

Protein

• Length: 135 a.a.
• Molecular weight: 14459.46 Da
• Isoelectric Point: 4.8165

>AT274266 WP_132940168.1 NZ_CP119676:1098938-1099342 [Varunaivibrio sulfuroxidans]
MAHYIALLRKEEESDFAVEFPDFPGCVTAGTTLDEAKDMAVEALALHIEGIREDGGGLPTPSRLETIMADPHNVGAVAFL
VDAPAVKEKAVRVNFTILESVLRRVDAHAKAQHLTRSAFLAEAAIKAISDNEHV

Nucleotide

• Length: 405 bp