Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3447314..3447951 | Replicon | chromosome |
Accession | NZ_CP119675 | ||
Organism | Bacillus velezensis strain 160 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PX690_RS17305 | Protein ID | WP_003156187.1 |
Coordinates | 3447601..3447951 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PX690_RS17300 | Protein ID | WP_003156188.1 |
Coordinates | 3447314..3447595 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX690_RS17280 (3443679) | 3443679..3444278 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PX690_RS17285 (3444371) | 3444371..3444736 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
PX690_RS17290 (3444901) | 3444901..3445908 | + | 1008 | WP_276123255.1 | outer membrane lipoprotein carrier protein LolA | - |
PX690_RS17295 (3446025) | 3446025..3447194 | + | 1170 | WP_003156189.1 | alanine racemase | - |
PX690_RS17300 (3447314) | 3447314..3447595 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PX690_RS17305 (3447601) | 3447601..3447951 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PX690_RS17310 (3448069) | 3448069..3448890 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PX690_RS17315 (3448895) | 3448895..3449260 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PX690_RS17320 (3449263) | 3449263..3449664 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PX690_RS17325 (3449676) | 3449676..3450683 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
PX690_RS17330 (3450747) | 3450747..3451076 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PX690_RS17335 (3451073) | 3451073..3451555 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
PX690_RS17340 (3451521) | 3451521..3452309 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PX690_RS17345 (3452309) | 3452309..3452911 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T274265 WP_003156187.1 NZ_CP119675:3447601-3447951 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|