Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2448116..2449091 | Replicon | chromosome |
Accession | NZ_CP119629 | ||
Organism | Bacillus paranthracis strain Bc006 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | C2MKV2 |
Locus tag | P3K65_RS12470 | Protein ID | WP_001997496.1 |
Coordinates | 2448116..2448853 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A402GGJ7 |
Locus tag | P3K65_RS12475 | Protein ID | WP_000594783.1 |
Coordinates | 2448966..2449091 (+) | Length | 42 a.a. |
Genomic Context
Location: 2443162..2443569 (408 bp)
Type: Others
Protein ID: WP_000072475.1
Type: Others
Protein ID: WP_000072475.1
Location: 2443854..2444636 (783 bp)
Type: Others
Protein ID: WP_000381793.1
Type: Others
Protein ID: WP_000381793.1
Location: 2446540..2447022 (483 bp)
Type: Others
Protein ID: WP_000191884.1
Type: Others
Protein ID: WP_000191884.1
Location: 2447190..2447927 (738 bp)
Type: Others
Protein ID: WP_000594125.1
Type: Others
Protein ID: WP_000594125.1
Location: 2448116..2448853 (738 bp)
Type: Toxin
Protein ID: WP_001997496.1
Type: Toxin
Protein ID: WP_001997496.1
Location: 2448966..2449091 (126 bp)
Type: Antitoxin
Protein ID: WP_000594783.1
Type: Antitoxin
Protein ID: WP_000594783.1
Location: 2449167..2449343 (177 bp)
Type: Others
Protein ID: WP_000819051.1
Type: Others
Protein ID: WP_000819051.1
Location: 2450221..2450397 (177 bp)
Type: Others
Protein ID: WP_000852621.1
Type: Others
Protein ID: WP_000852621.1
Location: 2451026..2452495 (1470 bp)
Type: Others
Protein ID: WP_000287532.1
Type: Others
Protein ID: WP_000287532.1
Location: 2444758..2446443 (1686 bp)
Type: Others
Protein ID: WP_001997495.1
Type: Others
Protein ID: WP_001997495.1
Location: 2449387..2449662 (276 bp)
Type: Others
Protein ID: WP_001041552.1
Type: Others
Protein ID: WP_001041552.1
Location: 2450421..2450810 (390 bp)
Type: Others
Protein ID: WP_000808872.1
Type: Others
Protein ID: WP_000808872.1
Location: 2453076..2453546 (471 bp)
Type: Others
Protein ID: WP_000771837.1
Type: Others
Protein ID: WP_000771837.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3K65_RS12445 (P3K65_12445) | 2443162..2443569 | + | 408 | WP_000072475.1 | VOC family protein | - |
P3K65_RS12450 (P3K65_12450) | 2443854..2444636 | + | 783 | WP_000381793.1 | class I SAM-dependent methyltransferase | - |
P3K65_RS12455 (P3K65_12455) | 2444758..2446443 | - | 1686 | WP_001997495.1 | alpha-keto acid decarboxylase family protein | - |
P3K65_RS12460 (P3K65_12460) | 2446540..2447022 | + | 483 | WP_000191884.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P3K65_RS12465 (P3K65_12465) | 2447190..2447927 | + | 738 | WP_000594125.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
P3K65_RS12470 (P3K65_12470) | 2448116..2448853 | + | 738 | WP_001997496.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
P3K65_RS12475 (P3K65_12475) | 2448966..2449091 | + | 126 | WP_000594783.1 | hypothetical protein | Antitoxin |
P3K65_RS12480 (P3K65_12480) | 2449167..2449343 | + | 177 | WP_000819051.1 | stage II sporulation protein SB | - |
P3K65_RS12485 (P3K65_12485) | 2449387..2449662 | - | 276 | WP_001041552.1 | hypothetical protein | - |
P3K65_RS12490 (P3K65_12490) | 2450221..2450397 | + | 177 | WP_000852621.1 | stage II sporulation protein SB | - |
P3K65_RS12495 (P3K65_12495) | 2450421..2450810 | - | 390 | WP_000808872.1 | YxeA family protein | - |
P3K65_RS12500 (P3K65_12500) | 2451026..2452495 | + | 1470 | WP_000287532.1 | beta-Ala-His dipeptidase | - |
P3K65_RS12505 (P3K65_12505) | 2453076..2453546 | - | 471 | WP_000771837.1 | DUF5065 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28377.08 Da Isoelectric Point: 8.2672
>T274259 WP_001997496.1 NZ_CP119629:2448116-2448853 [Bacillus paranthracis]
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTMIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTMIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T2Q3U8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A402GGJ7 |