Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1291898..1292510 | Replicon | chromosome |
| Accession | NZ_CP119599 | ||
| Organism | Streptococcus pyogenes strain 1133 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q5X9X8 |
| Locus tag | P1Y72_RS06100 | Protein ID | WP_011018227.1 |
| Coordinates | 1291898..1292233 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | P1Y72_RS06105 | Protein ID | WP_002988079.1 |
| Coordinates | 1292223..1292510 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1Y72_RS06065 (P1Y72_06065) | 1287276..1287794 | + | 519 | WP_002982682.1 | NYN domain-containing protein | - |
| P1Y72_RS06070 (P1Y72_06070) | 1287891..1288751 | + | 861 | WP_002982687.1 | DegV family protein | - |
| P1Y72_RS06075 (P1Y72_06075) | 1288887..1289393 | + | 507 | WP_002988070.1 | hypothetical protein | - |
| P1Y72_RS06080 (P1Y72_06080) | 1289390..1289596 | + | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| P1Y72_RS06085 (P1Y72_06085) | 1289814..1290260 | + | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| P1Y72_RS06090 (P1Y72_06090) | 1290281..1290673 | + | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| P1Y72_RS06095 (P1Y72_06095) | 1290793..1291800 | - | 1008 | Protein_1186 | site-specific integrase | - |
| P1Y72_RS06100 (P1Y72_06100) | 1291898..1292233 | - | 336 | WP_011018227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P1Y72_RS06105 (P1Y72_06105) | 1292223..1292510 | - | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| P1Y72_RS06110 (P1Y72_06110) | 1293171..1293944 | - | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1Y72_RS06115 (P1Y72_06115) | 1294391..1294819 | + | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
| P1Y72_RS06120 (P1Y72_06120) | 1294854..1295369 | + | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| P1Y72_RS06125 (P1Y72_06125) | 1295417..1296346 | + | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
| P1Y72_RS06130 (P1Y72_06130) | 1296350..1297333 | + | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13171.97 Da Isoelectric Point: 5.2144
>T274257 WP_011018227.1 NZ_CP119599:c1292233-1291898 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z2QKE7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |