Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1606499..1607111 | Replicon | chromosome |
Accession | NZ_CP119597 | ||
Organism | Streptococcus pyogenes strain 1039 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q5X9X8 |
Locus tag | P1J77_RS07935 | Protein ID | WP_011018227.1 |
Coordinates | 1606776..1607111 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | P1J77_RS07930 | Protein ID | WP_002988079.1 |
Coordinates | 1606499..1606786 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J77_RS07905 (P1J77_07905) | 1601676..1602659 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
P1J77_RS07910 (P1J77_07910) | 1602663..1603592 | - | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
P1J77_RS07915 (P1J77_07915) | 1603640..1604155 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
P1J77_RS07920 (P1J77_07920) | 1604190..1604618 | - | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
P1J77_RS07925 (P1J77_07925) | 1605065..1605838 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
P1J77_RS07930 (P1J77_07930) | 1606499..1606786 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
P1J77_RS07935 (P1J77_07935) | 1606776..1607111 | + | 336 | WP_011018227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1J77_RS07940 (P1J77_07940) | 1607209..1608216 | + | 1008 | Protein_1504 | site-specific integrase | - |
P1J77_RS07945 (P1J77_07945) | 1608336..1608728 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
P1J77_RS07950 (P1J77_07950) | 1608749..1609195 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
P1J77_RS07955 (P1J77_07955) | 1609413..1609619 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
P1J77_RS07960 (P1J77_07960) | 1609616..1610122 | - | 507 | WP_002988070.1 | hypothetical protein | - |
P1J77_RS07965 (P1J77_07965) | 1610258..1611118 | - | 861 | WP_002982687.1 | DegV family protein | - |
P1J77_RS07970 (P1J77_07970) | 1611215..1611733 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13171.97 Da Isoelectric Point: 5.2144
>T274255 WP_011018227.1 NZ_CP119597:1606776-1607111 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z2QKE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |