Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1253451..1254368 | Replicon | chromosome |
| Accession | NZ_CP119596 | ||
| Organism | Bacillus amyloliquefaciens strain MG-2 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | P1K87_RS06565 | Protein ID | WP_007407256.1 |
| Coordinates | 1253622..1254368 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | P1K87_RS06560 | Protein ID | WP_003154807.1 |
| Coordinates | 1253451..1253621 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1K87_RS06520 (P1K87_06520) | 1248684..1250306 | + | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
| P1K87_RS06525 (P1K87_06525) | 1250319..1250690 | + | 372 | WP_032874603.1 | XkdW family protein | - |
| P1K87_RS06530 (P1K87_06530) | 1250695..1250892 | + | 198 | WP_032874605.1 | XkdX family protein | - |
| P1K87_RS06535 (P1K87_06535) | 1250949..1251710 | + | 762 | WP_032874607.1 | hypothetical protein | - |
| P1K87_RS06540 (P1K87_06540) | 1251762..1252025 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| P1K87_RS06545 (P1K87_06545) | 1252039..1252302 | + | 264 | WP_003154813.1 | phage holin | - |
| P1K87_RS06550 (P1K87_06550) | 1252316..1253194 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P1K87_RS06555 (P1K87_06555) | 1253229..1253354 | - | 126 | WP_003154809.1 | hypothetical protein | - |
| P1K87_RS06560 (P1K87_06560) | 1253451..1253621 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| P1K87_RS06565 (P1K87_06565) | 1253622..1254368 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| P1K87_RS06570 (P1K87_06570) | 1254473..1255471 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
| P1K87_RS06575 (P1K87_06575) | 1255484..1256101 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
| P1K87_RS06580 (P1K87_06580) | 1256387..1257703 | - | 1317 | WP_032874616.1 | amino acid permease | - |
| P1K87_RS06585 (P1K87_06585) | 1258025..1258975 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T274254 WP_007407256.1 NZ_CP119596:c1254368-1253622 [Bacillus amyloliquefaciens]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|