Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 502211..502848 | Replicon | chromosome |
| Accession | NZ_CP119596 | ||
| Organism | Bacillus amyloliquefaciens strain MG-2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | P1K87_RS02585 | Protein ID | WP_003156187.1 |
| Coordinates | 502498..502848 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | P1K87_RS02580 | Protein ID | WP_003156188.1 |
| Coordinates | 502211..502492 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1K87_RS02560 (P1K87_02560) | 498576..499175 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
| P1K87_RS02565 (P1K87_02565) | 499268..499633 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| P1K87_RS02570 (P1K87_02570) | 499798..500805 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| P1K87_RS02575 (P1K87_02575) | 500922..502091 | + | 1170 | WP_032873001.1 | alanine racemase | - |
| P1K87_RS02580 (P1K87_02580) | 502211..502492 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| P1K87_RS02585 (P1K87_02585) | 502498..502848 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P1K87_RS02590 (P1K87_02590) | 502966..503787 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| P1K87_RS02595 (P1K87_02595) | 503792..504157 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| P1K87_RS02600 (P1K87_02600) | 504160..504561 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| P1K87_RS02605 (P1K87_02605) | 504573..505580 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| P1K87_RS02610 (P1K87_02610) | 505644..505973 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| P1K87_RS02615 (P1K87_02615) | 505970..506452 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| P1K87_RS02620 (P1K87_02620) | 506418..507206 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| P1K87_RS02625 (P1K87_02625) | 507206..507808 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T274253 WP_003156187.1 NZ_CP119596:502498-502848 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|