Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 40171..40693 Replicon plasmid pEC012-5
Accession NZ_CP119582
Organism Escherichia coli strain C012_chr

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag P1J04_RS26385 Protein ID WP_000638823.1
Coordinates 40412..40693 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag P1J04_RS26380 Protein ID WP_000121741.1
Coordinates 40171..40422 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J04_RS26335 (P1J04_26335) 35240..35410 + 171 WP_000550720.1 hypothetical protein -
P1J04_RS26340 (P1J04_26340) 35421..35633 + 213 WP_039022940.1 hypothetical protein -
P1J04_RS26345 (P1J04_26345) 35904..36206 + 303 WP_001360345.1 hypothetical protein -
P1J04_RS26350 (P1J04_26350) 36203..36460 + 258 WP_000739144.1 hypothetical protein -
P1J04_RS26355 (P1J04_26355) 36464..37459 + 996 WP_001028541.1 type IV secretion system protein -
P1J04_RS26360 (P1J04_26360) 37465..38109 + 645 WP_001310442.1 type IV secretion system protein -
P1J04_RS26365 (P1J04_26365) 38118..38342 + 225 WP_000713561.1 EexN family lipoprotein -
P1J04_RS26370 (P1J04_26370) 38597..39388 - 792 WP_022645137.1 DUF5710 domain-containing protein -
P1J04_RS26375 (P1J04_26375) 39436..40071 + 636 WP_022645136.1 hypothetical protein -
P1J04_RS26380 (P1J04_26380) 40171..40422 + 252 WP_000121741.1 hypothetical protein Antitoxin
P1J04_RS26385 (P1J04_26385) 40412..40693 + 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J04_RS26390 (P1J04_26390) 40761..41060 + 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
P1J04_RS26395 (P1J04_26395) 41063..42298 + 1236 WP_015059538.1 TcpQ domain-containing protein -
P1J04_RS26400 (P1J04_26400) 42304..42741 + 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
P1J04_RS26405 (P1J04_26405) 42860..43258 + 399 WP_001153669.1 hypothetical protein -
P1J04_RS26410 (P1J04_26410) 43279..43863 + 585 WP_001177114.1 lytic transglycosylase domain-containing protein -
P1J04_RS26415 (P1J04_26415) 43863..44153 + 291 WP_000865479.1 conjugal transfer protein -
P1J04_RS26420 (P1J04_26420) 44224..44544 + 321 WP_000362080.1 VirB3 family type IV secretion system protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..63996 63996


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T274252 WP_000638823.1 NZ_CP119582:40412-40693 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT274252 WP_000121741.1 NZ_CP119582:40171-40422 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References