Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 22115..22608 Replicon plasmid pEC012-5
Accession NZ_CP119582
Organism Escherichia coli strain C012_chr

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag P1J04_RS26245 Protein ID WP_001230709.1
Coordinates 22354..22608 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag P1J04_RS26240 Protein ID WP_000151456.1
Coordinates 22115..22357 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J04_RS26200 (P1J04_26200) 17518..18270 + 753 WP_000797966.1 conjugal transfer protein TraL -
P1J04_RS26205 (P1J04_26205) 18272..18979 + 708 WP_021503228.1 hypothetical protein -
P1J04_RS26210 (P1J04_26210) 18999..19325 + 327 WP_063078684.1 hypothetical protein -
P1J04_RS26215 (P1J04_26215) 19456..19893 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
P1J04_RS26220 (P1J04_26220) 19918..20100 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
P1J04_RS26225 (P1J04_26225) 20397..20840 + 444 WP_000068545.1 hypothetical protein -
P1J04_RS26230 (P1J04_26230) 21252..21545 - 294 WP_000673428.1 hypothetical protein -
P1J04_RS26235 (P1J04_26235) 21661..21894 - 234 WP_241225376.1 hypothetical protein -
P1J04_RS26240 (P1J04_26240) 22115..22357 - 243 WP_000151456.1 hypothetical protein Antitoxin
P1J04_RS26245 (P1J04_26245) 22354..22608 - 255 WP_001230709.1 hypothetical protein Toxin
P1J04_RS26250 (P1J04_26250) 22605..23147 - 543 WP_001083904.1 hypothetical protein -
P1J04_RS26255 (P1J04_26255) 23251..23766 - 516 WP_001025393.1 J domain-containing protein -
P1J04_RS26260 (P1J04_26260) 24167..24496 - 330 WP_001542022.1 hypothetical protein -
P1J04_RS26265 (P1J04_26265) 25085..25750 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
P1J04_RS26270 (P1J04_26270) 25824..26108 + 285 WP_001162371.1 hypothetical protein -
P1J04_RS26275 (P1J04_26275) 26126..26722 - 597 WP_000125165.1 ProQ/FINO family protein -
P1J04_RS26280 (P1J04_26280) 26872..26994 - 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
P1J04_RS26285 (P1J04_26285) 26939..27091 - 153 Protein_32 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..63996 63996


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T274251 WP_001230709.1 NZ_CP119582:c22608-22354 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT274251 WP_000151456.1 NZ_CP119582:c22357-22115 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References