Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 41057..41658 | Replicon | plasmid pEC012-4 |
| Accession | NZ_CP119581 | ||
| Organism | Escherichia coli strain C012_chr | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | F4TND7 |
| Locus tag | P1J04_RS25810 | Protein ID | WP_001216030.1 |
| Coordinates | 41057..41437 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | P1J04_RS25815 | Protein ID | WP_001190712.1 |
| Coordinates | 41437..41658 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J04_RS25785 (P1J04_25785) | 36497..37981 | - | 1485 | WP_000124150.1 | terminase | - |
| P1J04_RS25790 (P1J04_25790) | 37981..39174 | - | 1194 | WP_000219604.1 | terminase | - |
| P1J04_RS25795 (P1J04_25795) | 39261..39713 | - | 453 | WP_032305380.1 | hypothetical protein | - |
| P1J04_RS25800 (P1J04_25800) | 39802..40845 | - | 1044 | WP_000648833.1 | DUF968 domain-containing protein | - |
| P1J04_RS25805 (P1J04_25805) | 40873..41052 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| P1J04_RS25810 (P1J04_25810) | 41057..41437 | - | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| P1J04_RS25815 (P1J04_25815) | 41437..41658 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P1J04_RS25820 (P1J04_25820) | 41841..43397 | + | 1557 | WP_029401414.1 | type I restriction-modification system subunit M | - |
| P1J04_RS25825 (P1J04_25825) | 43394..44662 | + | 1269 | WP_029401415.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | ant(3'')-Ia / lnu(F) / aac(3)-IId / blaTEM-1B | - | 1..95921 | 95921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T274250 WP_001216030.1 NZ_CP119581:c41437-41057 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |