Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 46156..46954 | Replicon | plasmid pEC012-2 |
Accession | NZ_CP119579 | ||
Organism | Escherichia coli strain C012_chr |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | P1J04_RS24615 | Protein ID | WP_000072677.1 |
Coordinates | 46156..46677 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | P1J04_RS24620 | Protein ID | WP_001351987.1 |
Coordinates | 46685..46954 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J04_RS24600 (P1J04_24600) | 44705..45028 | + | 324 | WP_000064175.1 | hypothetical protein | - |
P1J04_RS24605 (P1J04_24605) | 45042..45734 | + | 693 | WP_012640731.1 | hypothetical protein | - |
P1J04_RS24610 (P1J04_24610) | 45736..45987 | + | 252 | WP_000901559.1 | hypothetical protein | - |
P1J04_RS24615 (P1J04_24615) | 46156..46677 | - | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
P1J04_RS24620 (P1J04_24620) | 46685..46954 | - | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
P1J04_RS24625 (P1J04_24625) | 47273..47941 | + | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
P1J04_RS24630 (P1J04_24630) | 47947..48300 | + | 354 | WP_160378290.1 | hypothetical protein | - |
P1J04_RS24635 (P1J04_24635) | 48361..49419 | - | 1059 | WP_001404393.1 | hypothetical protein | - |
P1J04_RS24640 (P1J04_24640) | 49709..50449 | + | 741 | WP_001717320.1 | hypothetical protein | - |
P1J04_RS24645 (P1J04_24645) | 50493..51833 | + | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-55 | - | 1..110648 | 110648 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T274244 WP_000072677.1 NZ_CP119579:c46677-46156 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |