Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3575537..3576374 | Replicon | chromosome |
Accession | NZ_CP119577 | ||
Organism | Escherichia coli strain C012_chr |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | P1J04_RS17465 | Protein ID | WP_000227784.1 |
Coordinates | 3575832..3576374 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | P1J04_RS17460 | Protein ID | WP_001297137.1 |
Coordinates | 3575537..3575848 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J04_RS17435 (3570557) | 3570557..3571504 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
P1J04_RS17440 (3571526) | 3571526..3573517 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
P1J04_RS17445 (3573507) | 3573507..3574121 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P1J04_RS17450 (3574121) | 3574121..3574450 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P1J04_RS17455 (3574462) | 3574462..3575352 | + | 891 | WP_000971336.1 | heme o synthase | - |
P1J04_RS17460 (3575537) | 3575537..3575848 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
P1J04_RS17465 (3575832) | 3575832..3576374 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
P1J04_RS17470 (3576430) | 3576430..3577365 | - | 936 | Protein_3412 | tetratricopeptide repeat protein | - |
P1J04_RS17475 (3577773) | 3577773..3579137 | + | 1365 | WP_001000974.1 | MFS transporter | - |
P1J04_RS17480 (3579265) | 3579265..3579756 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
P1J04_RS17485 (3579924) | 3579924..3580835 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T274238 WP_000227784.1 NZ_CP119577:3575832-3576374 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|