Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2440386..2441024 | Replicon | chromosome |
Accession | NZ_CP119577 | ||
Organism | Escherichia coli strain C012_chr |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P1J04_RS11740 | Protein ID | WP_000813794.1 |
Coordinates | 2440848..2441024 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P1J04_RS11735 | Protein ID | WP_001270286.1 |
Coordinates | 2440386..2440802 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J04_RS11715 (2435538) | 2435538..2436479 | - | 942 | WP_276131452.1 | ABC transporter permease | - |
P1J04_RS11720 (2436480) | 2436480..2437493 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
P1J04_RS11725 (2437511) | 2437511..2438656 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
P1J04_RS11730 (2438898) | 2438898..2440307 | - | 1410 | WP_112039768.1 | PLP-dependent aminotransferase family protein | - |
P1J04_RS11735 (2440386) | 2440386..2440802 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P1J04_RS11740 (2440848) | 2440848..2441024 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P1J04_RS11745 (2441246) | 2441246..2441476 | + | 231 | WP_000494244.1 | YncJ family protein | - |
P1J04_RS11750 (2441568) | 2441568..2443529 | - | 1962 | WP_001442195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P1J04_RS11755 (2443602) | 2443602..2444138 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
P1J04_RS11760 (2444230) | 2444230..2445405 | + | 1176 | WP_021565101.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2445445..2446593 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T274236 WP_000813794.1 NZ_CP119577:c2441024-2440848 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT274236 WP_001270286.1 NZ_CP119577:c2440802-2440386 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|