Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1376726..1377351 | Replicon | chromosome |
| Accession | NZ_CP119577 | ||
| Organism | Escherichia coli strain C012_chr | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P1J04_RS06680 | Protein ID | WP_000911330.1 |
| Coordinates | 1376953..1377351 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | P1J04_RS06675 | Protein ID | WP_000450524.1 |
| Coordinates | 1376726..1376953 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J04_RS06650 (1372529) | 1372529..1372999 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| P1J04_RS06655 (1372999) | 1372999..1373571 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| P1J04_RS06660 (1373717) | 1373717..1374595 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| P1J04_RS06665 (1374612) | 1374612..1375646 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| P1J04_RS06670 (1375859) | 1375859..1376572 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| P1J04_RS06675 (1376726) | 1376726..1376953 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P1J04_RS06680 (1376953) | 1376953..1377351 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1J04_RS06685 (1377498) | 1377498..1378361 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| P1J04_RS06690 (1378376) | 1378376..1380391 | + | 2016 | WP_021565358.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| P1J04_RS06695 (1380465) | 1380465..1381163 | + | 699 | WP_276131554.1 | esterase | - |
| P1J04_RS06700 (1381244) | 1381244..1381444 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T274229 WP_000911330.1 NZ_CP119577:1376953-1377351 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|