Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1142176..1143011 | Replicon | chromosome |
| Accession | NZ_CP119577 | ||
| Organism | Escherichia coli strain C012_chr | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | P1J04_RS05595 | Protein ID | WP_276131542.1 |
| Coordinates | 1142176..1142553 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7LDN9 |
| Locus tag | P1J04_RS05600 | Protein ID | WP_001285607.1 |
| Coordinates | 1142643..1143011 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J04_RS05570 (1137557) | 1137557..1139809 | - | 2253 | Protein_1089 | alpha-amylase family glycosyl hydrolase | - |
| P1J04_RS05580 (1140544) | 1140544..1141389 | - | 846 | WP_001280427.1 | DUF4942 domain-containing protein | - |
| P1J04_RS05585 (1141474) | 1141474..1141671 | - | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
| P1J04_RS05590 (1141691) | 1141691..1142179 | - | 489 | WP_000761669.1 | DUF5983 family protein | - |
| P1J04_RS05595 (1142176) | 1142176..1142553 | - | 378 | WP_276131542.1 | TA system toxin CbtA family protein | Toxin |
| P1J04_RS05600 (1142643) | 1142643..1143011 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P1J04_RS05605 (1143091) | 1143091..1143312 | - | 222 | WP_000692176.1 | DUF987 domain-containing protein | - |
| P1J04_RS05610 (1143399) | 1143399..1143875 | - | 477 | WP_001360063.1 | RadC family protein | - |
| P1J04_RS05615 (1143891) | 1143891..1144376 | - | 486 | WP_000206656.1 | antirestriction protein | - |
| P1J04_RS05620 (1144468) | 1144468..1145286 | - | 819 | WP_021520251.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1137968..1162534 | 24566 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14085.05 Da Isoelectric Point: 7.3523
>T274228 WP_276131542.1 NZ_CP119577:c1142553-1142176 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGILLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGILLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT274228 WP_001285607.1 NZ_CP119577:c1143011-1142643 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|