Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | sezT-pezT/zeta-couple_hipB |
| Location | 1585032..1586296 | Replicon | chromosome |
| Accession | NZ_CP119576 | ||
| Organism | Streptococcus agalactiae strain Guangzhou-SAG092 | ||
Toxin (Protein)
| Gene name | sezT | Uniprot ID | A0A8B2XHR8 |
| Locus tag | P1I87_RS08105 | Protein ID | WP_001235246.1 |
| Coordinates | 1585032..1585820 (-) | Length | 263 a.a. |
Antitoxin (Protein)
| Gene name | pezT | Uniprot ID | - |
| Locus tag | P1I87_RS08110 | Protein ID | WP_000578720.1 |
| Coordinates | 1585820..1586296 (-) | Length | 159 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1I87_RS08080 (P1I87_08080) | 1580097..1580462 | - | 366 | WP_000431640.1 | MobC family plasmid mobilization relaxosome protein | - |
| P1I87_RS08085 (P1I87_08085) | 1580465..1580827 | - | 363 | WP_000140674.1 | SAG1252 family conjugative relaxosome accessory protein | - |
| P1I87_RS08090 (P1I87_08090) | 1581530..1581757 | - | 228 | WP_223875823.1 | hypothetical protein | - |
| P1I87_RS08095 (P1I87_08095) | 1581754..1583295 | - | 1542 | WP_001279803.1 | UvrD-helicase domain-containing protein | - |
| P1I87_RS08100 (P1I87_08100) | 1583288..1585042 | - | 1755 | WP_000394601.1 | AAA family ATPase | - |
| P1I87_RS08105 (P1I87_08105) | 1585032..1585820 | - | 789 | WP_001235246.1 | type II toxin-antitoxin system toxin PezT | Toxin |
| P1I87_RS08110 (P1I87_08110) | 1585820..1586296 | - | 477 | WP_000578720.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
| P1I87_RS08115 (P1I87_08115) | 1586366..1586656 | - | 291 | WP_000667953.1 | hypothetical protein | - |
| P1I87_RS08120 (P1I87_08120) | 1586706..1587095 | - | 390 | WP_000048066.1 | DUF5945 family protein | - |
| P1I87_RS08125 (P1I87_08125) | 1587092..1587319 | - | 228 | WP_000110922.1 | DUF5965 family protein | - |
| P1I87_RS08130 (P1I87_08130) | 1587347..1588447 | - | 1101 | WP_050887019.1 | toprim domain-containing protein | - |
| P1I87_RS08135 (P1I87_08135) | 1588487..1589125 | - | 639 | WP_044758820.1 | hypothetical protein | - |
| P1I87_RS08140 (P1I87_08140) | 1589221..1589511 | - | 291 | WP_044758821.1 | DUF5966 family protein | - |
| P1I87_RS08145 (P1I87_08145) | 1589525..1589824 | - | 300 | WP_044758822.1 | DUF5962 family protein | - |
| P1I87_RS08150 (P1I87_08150) | 1589895..1590854 | - | 960 | Protein_1532 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(O) | cylK / cylJ / cylI / cylF / cylE / cylB / cylA / cylZ / acpC / cylG / cylD / cylX / gbs0632 / gbs0631 / gbs0630 / gbs0628 / gbs0628 | 1516033..1648959 | 132926 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 263 a.a. Molecular weight: 29881.95 Da Isoelectric Point: 6.5023
>T274221 WP_001235246.1 NZ_CP119576:c1585820-1585032 [Streptococcus agalactiae]
MRLEEFSEVEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSKRGYHLLIEGTLRTTQVPRQTAQLLTSKGYQVSLAIIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKDHHDGIVENLVDNLRELEREQLFDQIQIYQRDRACIYDSETDEGSAAEVLQDCLFGKCSKVEEEMM
KLGRERLVKLNNKNLLESNYGI
MRLEEFSEVEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSKRGYHLLIEGTLRTTQVPRQTAQLLTSKGYQVSLAIIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKDHHDGIVENLVDNLRELEREQLFDQIQIYQRDRACIYDSETDEGSAAEVLQDCLFGKCSKVEEEMM
KLGRERLVKLNNKNLLESNYGI
Download Length: 789 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18199.65 Da Isoelectric Point: 4.4582
>AT274221 WP_000578720.1 NZ_CP119576:c1586296-1585820 [Streptococcus agalactiae]
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
VIKERGAAILSQLYRYQDSQGIACDDETNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
VIKERGAAILSQLYRYQDSQGIACDDETNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
Download Length: 477 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|