Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 966904..967469 | Replicon | chromosome |
| Accession | NZ_CP119572 | ||
| Organism | Cupriavidus sp. WKF15 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CupriaWKF_RS04605 | Protein ID | WP_276099844.1 |
| Coordinates | 966904..967275 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CupriaWKF_RS04610 | Protein ID | WP_276099845.1 |
| Coordinates | 967272..967469 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CupriaWKF_RS04585 (CupriaWKF_04585) | 962010..962687 | - | 678 | WP_276099840.1 | VOC family protein | - |
| CupriaWKF_RS04590 (CupriaWKF_04590) | 962772..964310 | + | 1539 | WP_276099841.1 | PLP-dependent aminotransferase family protein | - |
| CupriaWKF_RS04595 (CupriaWKF_04595) | 964416..966317 | + | 1902 | WP_276099842.1 | molecular chaperone HtpG | - |
| CupriaWKF_RS04600 (CupriaWKF_04600) | 966390..966893 | + | 504 | WP_276099843.1 | DNA-deoxyinosine glycosylase | - |
| CupriaWKF_RS04605 (CupriaWKF_04605) | 966904..967275 | - | 372 | WP_276099844.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CupriaWKF_RS04610 (CupriaWKF_04610) | 967272..967469 | - | 198 | WP_276099845.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| CupriaWKF_RS04615 (CupriaWKF_04615) | 967625..968707 | - | 1083 | WP_276099846.1 | SRPBCC domain-containing protein | - |
| CupriaWKF_RS04620 (CupriaWKF_04620) | 968704..969072 | - | 369 | WP_276100667.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| CupriaWKF_RS04625 (CupriaWKF_04625) | 969244..970386 | + | 1143 | WP_276099847.1 | PLP-dependent cysteine synthase family protein | - |
| CupriaWKF_RS04630 (CupriaWKF_04630) | 970455..971327 | + | 873 | WP_276099848.1 | spermidine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 966904..975326 | 8422 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13664.82 Da Isoelectric Point: 4.8890
>T274219 WP_276099844.1 NZ_CP119572:c967275-966904 [Cupriavidus sp. WKF15]
MILVDTSVWIDHINASDPLLVSLLVEERVLAHPFVIGEISLGSLRNREVVLGALLDLPQAPIATPEETFYLIEREGLFNR
GIGYVDTSLLASARLHPGATIWTRDKRLKRVADELNLGAMLEH
MILVDTSVWIDHINASDPLLVSLLVEERVLAHPFVIGEISLGSLRNREVVLGALLDLPQAPIATPEETFYLIEREGLFNR
GIGYVDTSLLASARLHPGATIWTRDKRLKRVADELNLGAMLEH
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|