Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1378175..1378704 | Replicon | chromosome |
| Accession | NZ_CP119571 | ||
| Organism | Staphylococcus aureus strain N08CSA36 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PZ486_RS07080 | Protein ID | WP_000621175.1 |
| Coordinates | 1378175..1378537 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | PZ486_RS07085 | Protein ID | WP_000948331.1 |
| Coordinates | 1378534..1378704 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ486_RS07060 (PZ486_07060) | 1375153..1375923 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| PZ486_RS07065 (PZ486_07065) | 1375898..1376377 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| PZ486_RS07070 (PZ486_07070) | 1376379..1376705 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| PZ486_RS07075 (PZ486_07075) | 1376824..1377825 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| PZ486_RS07080 (PZ486_07080) | 1378175..1378537 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PZ486_RS07085 (PZ486_07085) | 1378534..1378704 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PZ486_RS07090 (PZ486_07090) | 1378789..1379937 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| PZ486_RS07095 (PZ486_07095) | 1380003..1380362 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| PZ486_RS07100 (PZ486_07100) | 1380366..1380857 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
| PZ486_RS07105 (PZ486_07105) | 1380844..1382427 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| PZ486_RS07110 (PZ486_07110) | 1382420..1382899 | - | 480 | WP_031590204.1 | hypothetical protein | - |
| PZ486_RS07115 (PZ486_07115) | 1383108..1383668 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T274213 WP_000621175.1 NZ_CP119571:c1378537-1378175 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|