Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1239232..1240020 Replicon chromosome
Accession NZ_CP119571
Organism Staphylococcus aureus strain N08CSA36

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag PZ486_RS06370 Protein ID WP_129409664.1
Coordinates 1239559..1240020 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag PZ486_RS06365 Protein ID WP_000333630.1
Coordinates 1239232..1239546 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZ486_RS06310 (PZ486_06310) 1234837..1235265 - 429 WP_031886357.1 single-stranded DNA-binding protein -
PZ486_RS06315 (PZ486_06315) 1235265..1235888 - 624 WP_000139720.1 DUF1071 domain-containing protein -
PZ486_RS06320 (PZ486_06320) 1235881..1236102 - 222 WP_000815401.1 DUF2483 family protein -
PZ486_RS06325 (PZ486_06325) 1236112..1236372 - 261 WP_031886358.1 DUF1108 family protein -
PZ486_RS06330 (PZ486_06330) 1236377..1236679 - 303 WP_000165363.1 DUF2482 family protein -
PZ486_RS06335 (PZ486_06335) 1236772..1236933 - 162 WP_000066017.1 DUF1270 domain-containing protein -
PZ486_RS06340 (PZ486_06340) 1236926..1237147 - 222 WP_000594790.1 hypothetical protein -
PZ486_RS06345 (PZ486_06345) 1237219..1237872 + 654 WP_031886359.1 hypothetical protein -
PZ486_RS06350 (PZ486_06350) 1237882..1238025 - 144 WP_000939498.1 hypothetical protein -
PZ486_RS06355 (PZ486_06355) 1238054..1238830 - 777 WP_001148544.1 Rha family transcriptional regulator -
PZ486_RS06360 (PZ486_06360) 1238844..1239080 - 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
PZ486_RS06365 (PZ486_06365) 1239232..1239546 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
PZ486_RS06370 (PZ486_06370) 1239559..1240020 + 462 WP_129409664.1 toxin Toxin
PZ486_RS06375 (PZ486_06375) 1240039..1240542 + 504 WP_129409663.1 hypothetical protein -
PZ486_RS06380 (PZ486_06380) 1240604..1241650 + 1047 WP_031886361.1 tyrosine-type recombinase/integrase -
PZ486_RS06385 (PZ486_06385) 1241695..1242840 + 1146 WP_057511308.1 radical SAM/CxCxxxxC motif protein YfkAB -
PZ486_RS06390 (PZ486_06390) 1243100..1243630 - 531 WP_000184383.1 acyl-CoA thioesterase -
PZ486_RS06395 (PZ486_06395) 1243720..1244976 - 1257 WP_001789555.1 aminopeptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1194948..1243630 48682


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18044.43 Da        Isoelectric Point: 4.6915

>T274212 WP_129409664.1 NZ_CP119571:1239559-1240020 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGAHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT274212 WP_000333630.1 NZ_CP119571:1239232-1239546 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References