Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 1239232..1240020 | Replicon | chromosome |
| Accession | NZ_CP119571 | ||
| Organism | Staphylococcus aureus strain N08CSA36 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | PZ486_RS06370 | Protein ID | WP_129409664.1 |
| Coordinates | 1239559..1240020 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | PZ486_RS06365 | Protein ID | WP_000333630.1 |
| Coordinates | 1239232..1239546 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ486_RS06310 (PZ486_06310) | 1234837..1235265 | - | 429 | WP_031886357.1 | single-stranded DNA-binding protein | - |
| PZ486_RS06315 (PZ486_06315) | 1235265..1235888 | - | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| PZ486_RS06320 (PZ486_06320) | 1235881..1236102 | - | 222 | WP_000815401.1 | DUF2483 family protein | - |
| PZ486_RS06325 (PZ486_06325) | 1236112..1236372 | - | 261 | WP_031886358.1 | DUF1108 family protein | - |
| PZ486_RS06330 (PZ486_06330) | 1236377..1236679 | - | 303 | WP_000165363.1 | DUF2482 family protein | - |
| PZ486_RS06335 (PZ486_06335) | 1236772..1236933 | - | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| PZ486_RS06340 (PZ486_06340) | 1236926..1237147 | - | 222 | WP_000594790.1 | hypothetical protein | - |
| PZ486_RS06345 (PZ486_06345) | 1237219..1237872 | + | 654 | WP_031886359.1 | hypothetical protein | - |
| PZ486_RS06350 (PZ486_06350) | 1237882..1238025 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| PZ486_RS06355 (PZ486_06355) | 1238054..1238830 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| PZ486_RS06360 (PZ486_06360) | 1238844..1239080 | - | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| PZ486_RS06365 (PZ486_06365) | 1239232..1239546 | + | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PZ486_RS06370 (PZ486_06370) | 1239559..1240020 | + | 462 | WP_129409664.1 | toxin | Toxin |
| PZ486_RS06375 (PZ486_06375) | 1240039..1240542 | + | 504 | WP_129409663.1 | hypothetical protein | - |
| PZ486_RS06380 (PZ486_06380) | 1240604..1241650 | + | 1047 | WP_031886361.1 | tyrosine-type recombinase/integrase | - |
| PZ486_RS06385 (PZ486_06385) | 1241695..1242840 | + | 1146 | WP_057511308.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| PZ486_RS06390 (PZ486_06390) | 1243100..1243630 | - | 531 | WP_000184383.1 | acyl-CoA thioesterase | - |
| PZ486_RS06395 (PZ486_06395) | 1243720..1244976 | - | 1257 | WP_001789555.1 | aminopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1194948..1243630 | 48682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18044.43 Da Isoelectric Point: 4.6915
>T274212 WP_129409664.1 NZ_CP119571:1239559-1240020 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGAHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGAHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|