Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 75943..76420 Replicon chromosome
Accession NZ_CP119571
Organism Staphylococcus aureus strain N08CSA36

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PZ486_RS00355 Protein ID WP_000052076.1
Coordinates 75943..76131 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PZ486_RS00360 Protein ID WP_001059690.1
Coordinates 76160..76420 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZ486_RS00325 (PZ486_00325) 71978..72454 + 477 WP_000824477.1 hypothetical protein -
PZ486_RS00330 (PZ486_00330) 72795..73481 + 687 WP_001641381.1 thermonuclease family protein -
PZ486_RS00335 (PZ486_00335) 73838..74038 + 201 WP_001059082.1 cold-shock protein -
PZ486_RS00340 (PZ486_00340) 74534..74752 - 219 WP_000005887.1 hypothetical protein -
PZ486_RS00345 (PZ486_00345) 74814..75098 - 285 WP_031590186.1 hypothetical protein -
PZ486_RS00350 (PZ486_00350) 75186..75755 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
PZ486_RS00355 (PZ486_00355) 75943..76131 - 189 WP_000052076.1 hypothetical protein Toxin
PZ486_RS00360 (PZ486_00360) 76160..76420 - 261 WP_001059690.1 hypothetical protein Antitoxin
PZ486_RS00365 (PZ486_00365) 76761..76964 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PZ486_RS00370 (PZ486_00370) 76961..77197 - 237 WP_000368687.1 hypothetical protein -
PZ486_RS00375 (PZ486_00375) 77422..78003 + 582 WP_001140697.1 histidine phosphatase family protein -
PZ486_RS00380 (PZ486_00380) 78076..78693 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
PZ486_RS00385 (PZ486_00385) 78849..79343 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PZ486_RS00390 (PZ486_00390) 79742..80164 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PZ486_RS00395 (PZ486_00395) 80312..81028 + 717 WP_031589686.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T274207 WP_000052076.1 NZ_CP119571:c76131-75943 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT274207 WP_001059690.1 NZ_CP119571:c76420-76160 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References