Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 477127..477758 | Replicon | plasmid p3 |
Accession | NZ_CP119568 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0Q7NZ40 |
Locus tag | PYR65_RS27745 | Protein ID | WP_060637099.1 |
Coordinates | 477357..477758 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR65_RS27740 | Protein ID | WP_276121979.1 |
Coordinates | 477127..477357 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS27720 | 472466..473659 | + | 1194 | WP_060641031.1 | CoA transferase | - |
PYR65_RS27725 | 473662..474810 | + | 1149 | WP_276121977.1 | extracellular solute-binding protein | - |
PYR65_RS27730 | 474820..475590 | + | 771 | WP_276121978.1 | enoyl-CoA hydratase/isomerase family protein | - |
PYR65_RS27735 | 475693..476838 | + | 1146 | WP_060641028.1 | fumarylacetoacetate hydrolase family protein | - |
PYR65_RS27740 | 477127..477357 | + | 231 | WP_276121979.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PYR65_RS27745 | 477357..477758 | + | 402 | WP_060637099.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PYR65_RS27750 | 478066..478710 | - | 645 | WP_276121980.1 | BA14K family protein | - |
PYR65_RS27755 | 479019..479828 | - | 810 | WP_276121981.1 | DUF1206 domain-containing protein | - |
PYR65_RS27760 | 480275..482446 | + | 2172 | WP_276121982.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | katA | 1..615005 | 615005 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14916.03 Da Isoelectric Point: 7.2438
>T274206 WP_060637099.1 NZ_CP119568:477357-477758 [Pararhizobium sp. T808]
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSASPEKNLPVVEGFAARLEVLAYDEPAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIVVTNNRREFDRVPGLRVEDWTG
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSASPEKNLPVVEGFAARLEVLAYDEPAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIVVTNNRREFDRVPGLRVEDWTG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|