Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 625228..625910 | Replicon | plasmid p2 |
Accession | NZ_CP119567 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYR65_RS24100 | Protein ID | WP_276121277.1 |
Coordinates | 625228..625659 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR65_RS24105 | Protein ID | WP_276121278.1 |
Coordinates | 625656..625910 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS24085 | 620775..623432 | + | 2658 | WP_276121274.1 | nitrate reductase | - |
PYR65_RS24090 | 623404..624894 | + | 1491 | WP_276121275.1 | siroheme synthase CysG | - |
PYR65_RS24095 | 624891..625211 | + | 321 | WP_276121276.1 | hypothetical protein | - |
PYR65_RS24100 | 625228..625659 | - | 432 | WP_276121277.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYR65_RS24105 | 625656..625910 | - | 255 | WP_276121278.1 | plasmid stabilization protein | Antitoxin |
PYR65_RS24110 | 626069..626398 | - | 330 | WP_276121279.1 | cupin domain-containing protein | - |
PYR65_RS24115 | 626410..627165 | - | 756 | WP_276121280.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
PYR65_RS24120 | 627162..628004 | - | 843 | WP_276121281.1 | 5-dehydro-4-deoxy-D-glucuronate isomerase | - |
PYR65_RS24125 | 628036..628773 | - | 738 | WP_060636901.1 | ATP-binding cassette domain-containing protein | - |
PYR65_RS24130 | 628773..629792 | - | 1020 | WP_200953565.1 | ABC transporter permease | - |
PYR65_RS24135 | 629865..630815 | - | 951 | WP_060636619.1 | substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..900497 | 900497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15602.11 Da Isoelectric Point: 4.8839
>T274204 WP_276121277.1 NZ_CP119567:c625659-625228 [Pararhizobium sp. T808]
MILLDTNVISEPWKPAPDETVVAWLDAQAVETLFISAITIAELRFGIAAMPAGKRQTILRDRLEVEVLPHFAGRILPFGV
ATSQFYSELMVRARLSGKAIGEADGYIAATAAENRLAVATRDINPFEAAGLKVINPWILQQLS
MILLDTNVISEPWKPAPDETVVAWLDAQAVETLFISAITIAELRFGIAAMPAGKRQTILRDRLEVEVLPHFAGRILPFGV
ATSQFYSELMVRARLSGKAIGEADGYIAATAAENRLAVATRDINPFEAAGLKVINPWILQQLS
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|