Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3589006..3589601 | Replicon | chromosome |
| Accession | NZ_CP119566 | ||
| Organism | Pararhizobium sp. T808 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A0Q7P9Y0 |
| Locus tag | PYR65_RS17650 | Protein ID | WP_060636412.1 |
| Coordinates | 3589311..3589601 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0Q7PLU6 |
| Locus tag | PYR65_RS17645 | Protein ID | WP_060636411.1 |
| Coordinates | 3589006..3589299 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYR65_RS17605 | 3584017..3584313 | + | 297 | WP_276118910.1 | hypothetical protein | - |
| PYR65_RS17610 | 3584330..3584731 | + | 402 | WP_276118911.1 | VOC family protein | - |
| PYR65_RS17615 | 3584735..3585178 | - | 444 | WP_060636406.1 | ribonuclease HI | - |
| PYR65_RS17620 | 3585175..3586155 | - | 981 | WP_276118912.1 | homoserine kinase | - |
| PYR65_RS17625 | 3586340..3587350 | - | 1011 | WP_276118913.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| PYR65_RS17630 | 3587354..3587719 | - | 366 | WP_276118914.1 | DUF1304 domain-containing protein | - |
| PYR65_RS17635 | 3587751..3588521 | - | 771 | WP_276121096.1 | SURF1 family protein | - |
| PYR65_RS17640 | 3588490..3588873 | - | 384 | WP_276118915.1 | DUF983 domain-containing protein | - |
| PYR65_RS17645 | 3589006..3589299 | - | 294 | WP_060636411.1 | putative addiction module antidote protein | Antitoxin |
| PYR65_RS17650 | 3589311..3589601 | - | 291 | WP_060636412.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYR65_RS17655 | 3589711..3590586 | - | 876 | WP_060636413.1 | cytochrome c oxidase subunit 3 | - |
| PYR65_RS17660 | 3590652..3591260 | - | 609 | WP_060636414.1 | cytochrome c oxidase assembly protein | - |
| PYR65_RS17665 | 3591270..3591410 | - | 141 | WP_060636415.1 | hypothetical protein | - |
| PYR65_RS17670 | 3591410..3592366 | - | 957 | WP_276121097.1 | heme o synthase | - |
| PYR65_RS17675 | 3592661..3594355 | - | 1695 | WP_060636417.1 | cytochrome c oxidase subunit I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10756.56 Da Isoelectric Point: 10.2260
>T274201 WP_060636412.1 NZ_CP119566:c3589601-3589311 [Pararhizobium sp. T808]
MLVFETTDVFKDWLFSLRDVKAKARILARIRSAEFGNLGDCAPVGEGVSEMRIHYGPGYRLYFKRRGDVVYLLLAGGDKS
SQKRDIAAALKMAKSL
MLVFETTDVFKDWLFSLRDVKAKARILARIRSAEFGNLGDCAPVGEGVSEMRIHYGPGYRLYFKRRGDVVYLLLAGGDKS
SQKRDIAAALKMAKSL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q7P9Y0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q7PLU6 |