Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 3589006..3589601 Replicon chromosome
Accession NZ_CP119566
Organism Pararhizobium sp. T808

Toxin (Protein)


Gene name PumA Uniprot ID A0A0Q7P9Y0
Locus tag PYR65_RS17650 Protein ID WP_060636412.1
Coordinates 3589311..3589601 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Q7PLU6
Locus tag PYR65_RS17645 Protein ID WP_060636411.1
Coordinates 3589006..3589299 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYR65_RS17605 3584017..3584313 + 297 WP_276118910.1 hypothetical protein -
PYR65_RS17610 3584330..3584731 + 402 WP_276118911.1 VOC family protein -
PYR65_RS17615 3584735..3585178 - 444 WP_060636406.1 ribonuclease HI -
PYR65_RS17620 3585175..3586155 - 981 WP_276118912.1 homoserine kinase -
PYR65_RS17625 3586340..3587350 - 1011 WP_276118913.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
PYR65_RS17630 3587354..3587719 - 366 WP_276118914.1 DUF1304 domain-containing protein -
PYR65_RS17635 3587751..3588521 - 771 WP_276121096.1 SURF1 family protein -
PYR65_RS17640 3588490..3588873 - 384 WP_276118915.1 DUF983 domain-containing protein -
PYR65_RS17645 3589006..3589299 - 294 WP_060636411.1 putative addiction module antidote protein Antitoxin
PYR65_RS17650 3589311..3589601 - 291 WP_060636412.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYR65_RS17655 3589711..3590586 - 876 WP_060636413.1 cytochrome c oxidase subunit 3 -
PYR65_RS17660 3590652..3591260 - 609 WP_060636414.1 cytochrome c oxidase assembly protein -
PYR65_RS17665 3591270..3591410 - 141 WP_060636415.1 hypothetical protein -
PYR65_RS17670 3591410..3592366 - 957 WP_276121097.1 heme o synthase -
PYR65_RS17675 3592661..3594355 - 1695 WP_060636417.1 cytochrome c oxidase subunit I -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(4-95)

Antitoxin

Uncharacterized protein HI1420

(3-89)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 10756.56 Da        Isoelectric Point: 10.2260

>T274201 WP_060636412.1 NZ_CP119566:c3589601-3589311 [Pararhizobium sp. T808]
MLVFETTDVFKDWLFSLRDVKAKARILARIRSAEFGNLGDCAPVGEGVSEMRIHYGPGYRLYFKRRGDVVYLLLAGGDKS
SQKRDIAAALKMAKSL

Download         Length: 291 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10536.95 Da        Isoelectric Point: 4.6313

>AT274201 WP_060636411.1 NZ_CP119566:c3589299-3589006 [Pararhizobium sp. T808]
MTTVSRFDASEFLDDDDLVAEYLTAAMEDDNPDVFIAALGDVAKARGMTEIARASGLGRESLYKSLRGGSKARFETLHKI
VNTLGLKMTIVADRPTP

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q7P9Y0

Antitoxin

Source ID Structure
AlphaFold DB A0A0Q7PLU6

References