Detailed information of TA system TA274200

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): pasABC/RelE-HTH
• Location: 3522039..3522516
• Replicon: chromosome
• Accession: NZ_CP119566
• Organism: Pararhizobium sp. T808

Toxin (Protein)

• Gene name: pasB
• Uniprot ID: -
• Locus tag: PYR65_RS17270
• Protein ID: WP_276118863.1
• Coordinates: 3522250..3522516 (+)
• Length: 89 a.a.

Antitoxin (Protein)

• Gene name: pasA
• Uniprot ID: -
• Locus tag: PYR65_RS17265
• Protein ID: WP_276118862.1
• Coordinates: 3522039..3522266 (+)
• Length: 76 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PYR65_RS17230	3517496..3518398	-	903	WP_276118855.1	LysR substrate-binding domain-containing protein	-
PYR65_RS17235	3518491..3518688	+	198	WP_276118856.1	hypothetical protein	-
PYR65_RS17240	3518734..3519351	-	618	WP_276118857.1	glutathione S-transferase family protein	-
PYR65_RS17245	3519507..3519824	-	318	WP_276118858.1	HigA family addiction module antitoxin	-
PYR65_RS17250	3519799..3520080	-	282	WP_276118859.1	type II toxin-antitoxin system RelE/ParE family toxin	-
PYR65_RS17255	3520123..3521130	-	1008	WP_276118860.1	asparaginase	-
PYR65_RS17260	3521206..3521943	+	738	WP_276118861.1	DUF3750 domain-containing protein	-
PYR65_RS17265	3522039..3522266	+	228	WP_276118862.1	DUF6290 family protein	Antitoxin
PYR65_RS17270	3522250..3522516	+	267	WP_276118863.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PYR65_RS17275	3522837..3523835	-	999	WP_276118864.1	NAD(P)H-quinone oxidoreductase	-
PYR65_RS17280	3524150..3524410	+	261	WP_276118865.1	DUF1344 domain-containing protein	-
PYR65_RS17285	3524530..3526335	-	1806	WP_060639903.1	EAL domain-containing protein	-
PYR65_RS17290	3526491..3527039	-	549	WP_276118866.1	HdeD family acid-resistance protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (5-87)

Antitoxin

• Protein of unknown function DUF6290 (2-71)

Sequences

Toxin

Protein

• Length: 89 a.a.
• Molecular weight: 10189.79 Da
• Isoelectric Point: 10.3650

>T274200 WP_276118863.1 NZ_CP119566:3522250-3522516 [Pararhizobium sp. T808]
MAWTIEITARARKNISSLDKQAASRILSFLSDRLAASDNPRQLGKQLAGPLKHYWSYRVGDYRLLCEIKDDRLIVLVLEV
GNRRDIYR

Nucleotide

• Length: 267 bp

Antitoxin

Protein

• Length: 76 a.a.
• Molecular weight: 8603.54 Da
• Isoelectric Point: 4.4169

>AT274200 WP_276118862.1 NZ_CP119566:3522039-3522266 [Pararhizobium sp. T808]
MTLSIRLSDADEKQLEQLARETGQSKEFHVHQFIRQGLEDIEDYNIAAEIAKRVRNGEEAVYSLAEVRKDLGLDD

Nucleotide

• Length: 228 bp