Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 3479456..3480053 Replicon chromosome
Accession NZ_CP119566
Organism Pararhizobium sp. T808

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag PYR65_RS17015 Protein ID WP_276121089.1
Coordinates 3479456..3479644 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PYR65_RS17020 Protein ID WP_276118824.1
Coordinates 3479649..3480053 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYR65_RS16990 3474518..3474757 - 240 WP_276118819.1 hypothetical protein -
PYR65_RS16995 3474797..3475132 - 336 WP_276118820.1 hypothetical protein -
PYR65_RS17000 3475110..3477452 + 2343 WP_276118821.1 glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase -
PYR65_RS17005 3477558..3478442 - 885 WP_276118822.1 class A beta-lactamase -
PYR65_RS17010 3478818..3479309 + 492 WP_276118823.1 GNAT family N-acetyltransferase -
PYR65_RS17015 3479456..3479644 + 189 WP_276121089.1 type II toxin-antitoxin system HicA family toxin Toxin
PYR65_RS17020 3479649..3480053 + 405 WP_276118824.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PYR65_RS17025 3480069..3480278 - 210 WP_276118825.1 type II toxin-antitoxin system HicB family antitoxin -
PYR65_RS17030 3480354..3481271 - 918 WP_276118826.1 cytochrome c -
PYR65_RS17035 3481379..3481816 - 438 WP_060639884.1 cytochrome c -
PYR65_RS17040 3482000..3482630 - 631 Protein_3352 LysE family translocator -
PYR65_RS17045 3482767..3483483 + 717 WP_276118827.1 YafY family protein -
PYR65_RS17050 3483485..3483715 - 231 WP_276118828.1 hypothetical protein -
PYR65_RS17055 3483810..3484655 - 846 WP_276118829.1 metallophosphoesterase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7027.16 Da        Isoelectric Point: 11.1468

>T274199 WP_276121089.1 NZ_CP119566:3479456-3479644 [Pararhizobium sp. T808]
ILSSDVISNLRKDGWYEVARKGSHVQFKHPGKPGRVTVPHPRRDIPIGTLKSIEKQADLKLR

Download         Length: 189 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14495.31 Da        Isoelectric Point: 4.4454

>AT274199 WP_276118824.1 NZ_CP119566:3479649-3480053 [Pararhizobium sp. T808]
MRNYIGLIHKDPGSDYGVSFPDFPGVISAGTDLDDARQMASEALAFHLEGLVEDGSNIPEPSSLENIMADADNRKGVAIL
VGVRMETKKAVRVNVTLPEDVLRQIDRFAESKGLTRSGFIALAALHEIDRDDAA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References