Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 3479456..3480053 | Replicon | chromosome |
| Accession | NZ_CP119566 | ||
| Organism | Pararhizobium sp. T808 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PYR65_RS17015 | Protein ID | WP_276121089.1 |
| Coordinates | 3479456..3479644 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PYR65_RS17020 | Protein ID | WP_276118824.1 |
| Coordinates | 3479649..3480053 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYR65_RS16990 | 3474518..3474757 | - | 240 | WP_276118819.1 | hypothetical protein | - |
| PYR65_RS16995 | 3474797..3475132 | - | 336 | WP_276118820.1 | hypothetical protein | - |
| PYR65_RS17000 | 3475110..3477452 | + | 2343 | WP_276118821.1 | glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase | - |
| PYR65_RS17005 | 3477558..3478442 | - | 885 | WP_276118822.1 | class A beta-lactamase | - |
| PYR65_RS17010 | 3478818..3479309 | + | 492 | WP_276118823.1 | GNAT family N-acetyltransferase | - |
| PYR65_RS17015 | 3479456..3479644 | + | 189 | WP_276121089.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PYR65_RS17020 | 3479649..3480053 | + | 405 | WP_276118824.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PYR65_RS17025 | 3480069..3480278 | - | 210 | WP_276118825.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PYR65_RS17030 | 3480354..3481271 | - | 918 | WP_276118826.1 | cytochrome c | - |
| PYR65_RS17035 | 3481379..3481816 | - | 438 | WP_060639884.1 | cytochrome c | - |
| PYR65_RS17040 | 3482000..3482630 | - | 631 | Protein_3352 | LysE family translocator | - |
| PYR65_RS17045 | 3482767..3483483 | + | 717 | WP_276118827.1 | YafY family protein | - |
| PYR65_RS17050 | 3483485..3483715 | - | 231 | WP_276118828.1 | hypothetical protein | - |
| PYR65_RS17055 | 3483810..3484655 | - | 846 | WP_276118829.1 | metallophosphoesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7027.16 Da Isoelectric Point: 11.1468
>T274199 WP_276121089.1 NZ_CP119566:3479456-3479644 [Pararhizobium sp. T808]
ILSSDVISNLRKDGWYEVARKGSHVQFKHPGKPGRVTVPHPRRDIPIGTLKSIEKQADLKLR
ILSSDVISNLRKDGWYEVARKGSHVQFKHPGKPGRVTVPHPRRDIPIGTLKSIEKQADLKLR
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.4454
>AT274199 WP_276118824.1 NZ_CP119566:3479649-3480053 [Pararhizobium sp. T808]
MRNYIGLIHKDPGSDYGVSFPDFPGVISAGTDLDDARQMASEALAFHLEGLVEDGSNIPEPSSLENIMADADNRKGVAIL
VGVRMETKKAVRVNVTLPEDVLRQIDRFAESKGLTRSGFIALAALHEIDRDDAA
MRNYIGLIHKDPGSDYGVSFPDFPGVISAGTDLDDARQMASEALAFHLEGLVEDGSNIPEPSSLENIMADADNRKGVAIL
VGVRMETKKAVRVNVTLPEDVLRQIDRFAESKGLTRSGFIALAALHEIDRDDAA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|