Detailed information of TA system TA274199

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicB-HicA
• Location: 3479456..3480053
• Replicon: chromosome
• Accession: NZ_CP119566
• Organism: Pararhizobium sp. T808

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: -
• Locus tag: PYR65_RS17015
• Protein ID: WP_276121089.1
• Coordinates: 3479456..3479644 (+)
• Length: 63 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: -
• Locus tag: PYR65_RS17020
• Protein ID: WP_276118824.1
• Coordinates: 3479649..3480053 (+)
• Length: 135 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PYR65_RS16990	3474518..3474757	-	240	WP_276118819.1	hypothetical protein	-
PYR65_RS16995	3474797..3475132	-	336	WP_276118820.1	hypothetical protein	-
PYR65_RS17000	3475110..3477452	+	2343	WP_276118821.1	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	-
PYR65_RS17005	3477558..3478442	-	885	WP_276118822.1	class A beta-lactamase	-
PYR65_RS17010	3478818..3479309	+	492	WP_276118823.1	GNAT family N-acetyltransferase	-
PYR65_RS17015	3479456..3479644	+	189	WP_276121089.1	type II toxin-antitoxin system HicA family toxin	Toxin
PYR65_RS17020	3479649..3480053	+	405	WP_276118824.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
PYR65_RS17025	3480069..3480278	-	210	WP_276118825.1	type II toxin-antitoxin system HicB family antitoxin	-
PYR65_RS17030	3480354..3481271	-	918	WP_276118826.1	cytochrome c	-
PYR65_RS17035	3481379..3481816	-	438	WP_060639884.1	cytochrome c	-
PYR65_RS17040	3482000..3482630	-	631	Protein_3352	LysE family translocator	-
PYR65_RS17045	3482767..3483483	+	717	WP_276118827.1	YafY family protein	-
PYR65_RS17050	3483485..3483715	-	231	WP_276118828.1	hypothetical protein	-
PYR65_RS17055	3483810..3484655	-	846	WP_276118829.1	metallophosphoesterase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (4-59)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (4-124)

Sequences

Toxin

Protein

• Length: 63 a.a.
• Molecular weight: 7027.16 Da
• Isoelectric Point: 11.1468

>T274199 WP_276121089.1 NZ_CP119566:3479456-3479644 [Pararhizobium sp. T808]
ILSSDVISNLRKDGWYEVARKGSHVQFKHPGKPGRVTVPHPRRDIPIGTLKSIEKQADLKLR

Nucleotide

• Length: 189 bp

Antitoxin

Protein

• Length: 135 a.a.
• Molecular weight: 14495.31 Da
• Isoelectric Point: 4.4454

>AT274199 WP_276118824.1 NZ_CP119566:3479649-3480053 [Pararhizobium sp. T808]
MRNYIGLIHKDPGSDYGVSFPDFPGVISAGTDLDDARQMASEALAFHLEGLVEDGSNIPEPSSLENIMADADNRKGVAIL
VGVRMETKKAVRVNVTLPEDVLRQIDRFAESKGLTRSGFIALAALHEIDRDDAA

Nucleotide

• Length: 405 bp