Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3319974..3320647 | Replicon | chromosome |
Accession | NZ_CP119566 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYR65_RS16190 | Protein ID | WP_276118706.1 |
Coordinates | 3319974..3320396 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR65_RS16195 | Protein ID | WP_276118707.1 |
Coordinates | 3320393..3320647 (-) | Length | 85 a.a. |
Genomic Context
Location: 3315168..3315455 (288 bp)
Type: Others
Protein ID: WP_276118700.1
Type: Others
Protein ID: WP_276118700.1
Location: 3315452..3315751 (300 bp)
Type: Others
Protein ID: WP_276118701.1
Type: Others
Protein ID: WP_276118701.1
Location: 3322509..3322646 (138 bp)
Type: Others
Protein ID: WP_200953657.1
Type: Others
Protein ID: WP_200953657.1
Location: 3324514..3324951 (438 bp)
Type: Others
Protein ID: WP_276118711.1
Type: Others
Protein ID: WP_276118711.1
Location: 3325006..3325428 (423 bp)
Type: Others
Protein ID: WP_276118712.1
Type: Others
Protein ID: WP_276118712.1
Location: 3315761..3317377 (1617 bp)
Type: Others
Protein ID: WP_276118702.1
Type: Others
Protein ID: WP_276118702.1
Location: 3317537..3318496 (960 bp)
Type: Others
Protein ID: WP_276118703.1
Type: Others
Protein ID: WP_276118703.1
Location: 3318532..3319002 (471 bp)
Type: Others
Protein ID: WP_276118704.1
Type: Others
Protein ID: WP_276118704.1
Location: 3319004..3319498 (495 bp)
Type: Others
Protein ID: WP_276118705.1
Type: Others
Protein ID: WP_276118705.1
Location: 3319495..3319977 (483 bp)
Type: Others
Protein ID: WP_060641371.1
Type: Others
Protein ID: WP_060641371.1
Location: 3319974..3320396 (423 bp)
Type: Toxin
Protein ID: WP_276118706.1
Type: Toxin
Protein ID: WP_276118706.1
Location: 3320393..3320647 (255 bp)
Type: Antitoxin
Protein ID: WP_276118707.1
Type: Antitoxin
Protein ID: WP_276118707.1
Location: 3320704..3322095 (1392 bp)
Type: Others
Protein ID: WP_276118708.1
Type: Others
Protein ID: WP_276118708.1
Location: 3322667..3323446 (780 bp)
Type: Others
Protein ID: WP_276118709.1
Type: Others
Protein ID: WP_276118709.1
Location: 3323448..3324134 (687 bp)
Type: Others
Protein ID: WP_276118710.1
Type: Others
Protein ID: WP_276118710.1
Location: 3324131..3324400 (270 bp)
Type: Others
Protein ID: WP_244490300.1
Type: Others
Protein ID: WP_244490300.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS16155 | 3315168..3315455 | + | 288 | WP_276118700.1 | type II toxin-antitoxin system ParD family antitoxin | - |
PYR65_RS16160 | 3315452..3315751 | + | 300 | WP_276118701.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PYR65_RS16165 | 3315761..3317377 | - | 1617 | WP_276118702.1 | citramalate synthase | - |
PYR65_RS16170 | 3317537..3318496 | - | 960 | WP_276118703.1 | prolyl aminopeptidase | - |
PYR65_RS16175 | 3318532..3319002 | - | 471 | WP_276118704.1 | GFA family protein | - |
PYR65_RS16180 | 3319004..3319498 | - | 495 | WP_276118705.1 | GFA family protein | - |
PYR65_RS16185 | 3319495..3319977 | - | 483 | WP_060641371.1 | GFA family protein | - |
PYR65_RS16190 | 3319974..3320396 | - | 423 | WP_276118706.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYR65_RS16195 | 3320393..3320647 | - | 255 | WP_276118707.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PYR65_RS16200 | 3320704..3322095 | - | 1392 | WP_276118708.1 | cysteine--tRNA ligase | - |
PYR65_RS16205 | 3322509..3322646 | + | 138 | WP_200953657.1 | hypothetical protein | - |
PYR65_RS16210 | 3322667..3323446 | - | 780 | WP_276118709.1 | SOS response-associated peptidase | - |
PYR65_RS16215 | 3323448..3324134 | - | 687 | WP_276118710.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
PYR65_RS16220 | 3324131..3324400 | - | 270 | WP_244490300.1 | hypothetical protein | - |
PYR65_RS16225 | 3324514..3324951 | + | 438 | WP_276118711.1 | NUDIX domain-containing protein | - |
PYR65_RS16230 | 3325006..3325428 | + | 423 | WP_276118712.1 | TIGR02301 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3315452..3324400 | 8948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15360.52 Da Isoelectric Point: 5.1784
>T274198 WP_276118706.1 NZ_CP119566:c3320396-3319974 [Pararhizobium sp. T808]
VSGLVYMLDTNILSDTIRNPFGVASQYMERVSEDALCVSAIVASEMRYGIRKKGSPRLSYLVENTLSRIAILPYDDAASQ
SYSVIRTALERQGKSIGLADLLIAAHALSLGLTIVTNNTREFSRVEGLTIENWLAAEEHP
VSGLVYMLDTNILSDTIRNPFGVASQYMERVSEDALCVSAIVASEMRYGIRKKGSPRLSYLVENTLSRIAILPYDDAASQ
SYSVIRTALERQGKSIGLADLLIAAHALSLGLTIVTNNTREFSRVEGLTIENWLAAEEHP
Download Length: 423 bp