Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3319974..3320647 Replicon chromosome
Accession NZ_CP119566
Organism Pararhizobium sp. T808

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PYR65_RS16190 Protein ID WP_276118706.1
Coordinates 3319974..3320396 (-) Length 141 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PYR65_RS16195 Protein ID WP_276118707.1
Coordinates 3320393..3320647 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYR65_RS16155 3315168..3315455 + 288 WP_276118700.1 type II toxin-antitoxin system ParD family antitoxin -
PYR65_RS16160 3315452..3315751 + 300 WP_276118701.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYR65_RS16165 3315761..3317377 - 1617 WP_276118702.1 citramalate synthase -
PYR65_RS16170 3317537..3318496 - 960 WP_276118703.1 prolyl aminopeptidase -
PYR65_RS16175 3318532..3319002 - 471 WP_276118704.1 GFA family protein -
PYR65_RS16180 3319004..3319498 - 495 WP_276118705.1 GFA family protein -
PYR65_RS16185 3319495..3319977 - 483 WP_060641371.1 GFA family protein -
PYR65_RS16190 3319974..3320396 - 423 WP_276118706.1 type II toxin-antitoxin system VapC family toxin Toxin
PYR65_RS16195 3320393..3320647 - 255 WP_276118707.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PYR65_RS16200 3320704..3322095 - 1392 WP_276118708.1 cysteine--tRNA ligase -
PYR65_RS16205 3322509..3322646 + 138 WP_200953657.1 hypothetical protein -
PYR65_RS16210 3322667..3323446 - 780 WP_276118709.1 SOS response-associated peptidase -
PYR65_RS16215 3323448..3324134 - 687 WP_276118710.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PYR65_RS16220 3324131..3324400 - 270 WP_244490300.1 hypothetical protein -
PYR65_RS16225 3324514..3324951 + 438 WP_276118711.1 NUDIX domain-containing protein -
PYR65_RS16230 3325006..3325428 + 423 WP_276118712.1 TIGR02301 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3315452..3324400 8948


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-126)

Antitoxin

SpoVT-AbrB domain

(15-59)


Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 15360.52 Da        Isoelectric Point: 5.1784

>T274198 WP_276118706.1 NZ_CP119566:c3320396-3319974 [Pararhizobium sp. T808]
VSGLVYMLDTNILSDTIRNPFGVASQYMERVSEDALCVSAIVASEMRYGIRKKGSPRLSYLVENTLSRIAILPYDDAASQ
SYSVIRTALERQGKSIGLADLLIAAHALSLGLTIVTNNTREFSRVEGLTIENWLAAEEHP

Download         Length: 423 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9714.11 Da        Isoelectric Point: 4.4909

>AT274198 WP_276118707.1 NZ_CP119566:c3320647-3320393 [Pararhizobium sp. T808]
MTVIHVDEGREVKLFRNGRNQAVRIPVEFELPGNEAIMRKEGDCLIIEPKKKSGLLEWLRAQEPLDEEFPDLDEKSPPPK
DFDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References