Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2578892..2579571 | Replicon | chromosome |
Accession | NZ_CP119566 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYR65_RS12370 | Protein ID | WP_276118193.1 |
Coordinates | 2578892..2579320 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR65_RS12375 | Protein ID | WP_276118194.1 |
Coordinates | 2579317..2579571 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS12345 | 2574450..2574965 | + | 516 | WP_276118188.1 | hypothetical protein | - |
PYR65_RS12350 | 2575056..2575889 | + | 834 | WP_276118189.1 | RNA methyltransferase | - |
PYR65_RS12355 | 2575876..2576679 | + | 804 | WP_276118190.1 | glutamate racemase | - |
PYR65_RS12360 | 2576813..2577205 | + | 393 | WP_276118191.1 | VOC family protein | - |
PYR65_RS12365 | 2577376..2578890 | + | 1515 | WP_276118192.1 | ATP-binding protein | - |
PYR65_RS12370 | 2578892..2579320 | - | 429 | WP_276118193.1 | PIN domain-containing protein | Toxin |
PYR65_RS12375 | 2579317..2579571 | - | 255 | WP_276118194.1 | CopG family transcriptional regulator | Antitoxin |
PYR65_RS12380 | 2579882..2580499 | + | 618 | WP_060640871.1 | 30S ribosomal protein S4 | - |
PYR65_RS12385 | 2580603..2581541 | + | 939 | WP_060640872.1 | glutaminase | - |
PYR65_RS12390 | 2581753..2582565 | + | 813 | WP_244490285.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
PYR65_RS12395 | 2582562..2583386 | + | 825 | WP_276118195.1 | inositol monophosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15642.98 Da Isoelectric Point: 6.7489
>T274196 WP_276118193.1 NZ_CP119566:c2579320-2578892 [Pararhizobium sp. T808]
MTFLLDVNVLIALADSSHSHYSVATSWFEKIGQKDWATCPITENGMIRILSDPRYGSPVPDAAMATELLQLFRLTGKHSF
WHDDISLTDPGIFIRDKVTSKHTTDIYLLGLAKAHGGRLATFDRRLATQAVIGGSDILCLLA
MTFLLDVNVLIALADSSHSHYSVATSWFEKIGQKDWATCPITENGMIRILSDPRYGSPVPDAAMATELLQLFRLTGKHSF
WHDDISLTDPGIFIRDKVTSKHTTDIYLLGLAKAHGGRLATFDRRLATQAVIGGSDILCLLA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|