Detailed information of TA system TA274194

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): BrnTA/BrnT-BrnA
• Location: 1275355..1275913
• Replicon: chromosome
• Accession: NZ_CP119566
• Organism: Pararhizobium sp. T808

Toxin (Protein)

• Gene name: brnT
• Uniprot ID: -
• Locus tag: PYR65_RS06045
• Protein ID: WP_276120304.1
• Coordinates: 1275355..1275609 (+)
• Length: 85 a.a.

Antitoxin (Protein)

• Gene name: brnA
• Uniprot ID: -
• Locus tag: PYR65_RS06050
• Protein ID: WP_276120305.1
• Coordinates: 1275596..1275913 (+)
• Length: 106 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PYR65_RS06005	1271277..1271549	+	273	WP_060639397.1	DUF4164 domain-containing protein	-
PYR65_RS06010	1271580..1271957	+	378	WP_276120299.1	cell division protein ZapA	-
PYR65_RS06020	1272199..1273071	-	873	WP_276120300.1	LysR family transcriptional regulator	-
PYR65_RS06025	1273176..1273397	+	222	WP_276120301.1	hypothetical protein	-
PYR65_RS06030	1273392..1273604	-	213	WP_060639582.1	LuxR C-terminal-related transcriptional regulator	-
PYR65_RS06035	1273887..1274498	+	612	WP_276120302.1	5-formyltetrahydrofolate cyclo-ligase	-
PYR65_RS06040	1274476..1275300	+	825	WP_276120303.1	TIGR00282 family metallophosphoesterase	-
PYR65_RS06045	1275355..1275609	+	255	WP_276120304.1	BrnT family toxin	Toxin
PYR65_RS06050	1275596..1275913	+	318	WP_276120305.1	BrnA antitoxin family protein	Antitoxin
PYR65_RS06055	1276031..1276870	+	840	WP_276120306.1	MBL fold metallo-hydrolase	-
PYR65_RS06060	1276888..1277367	+	480	WP_276120307.1	hypothetical protein	-
PYR65_RS06065	1277455..1278201	+	747	WP_037099910.1	YebC/PmpR family DNA-binding transcriptional regulator	-
PYR65_RS06070	1278294..1278650	+	357	WP_276120308.1	cupin domain-containing protein	-
PYR65_RS06075	1278700..1279701	-	1002	WP_276120309.1	LLM class flavin-dependent oxidoreductase	-
PYR65_RS06080	1279875..1280387	+	513	WP_276120981.1	crossover junction endodeoxyribonuclease RuvC	-
PYR65_RS06085	1280442..1280690	+	249	WP_276120310.1	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (5-77)

Antitoxin

• BrnA antitoxin of type II toxin-antitoxin system (31-103)

Sequences

Toxin

Protein

• Length: 85 a.a.
• Molecular weight: 9682.38 Da
• Isoelectric Point: 10.0519

>T274194 WP_276120304.1 NZ_CP119566:1275355-1275609 [Pararhizobium sp. T808]
MKIVYDENKRRLNLAKHGFDFVTLDMGFFQSALIVETKLNRMKAIGLFDDGKISVVFFRLGSEGISIISMRAASRMERKL
YDQC

Nucleotide

• Length: 255 bp

Antitoxin

Protein

• Length: 106 a.a.
• Molecular weight: 11958.54 Da
• Isoelectric Point: 8.5600

>AT274194 WP_276120305.1 NZ_CP119566:1275596-1275913 [Pararhizobium sp. T808]
MTSAKSFKYDIPPLTDEEEARIQAGIAADPDNPEWTEEDFKRARPFAEVFPEFAESIRRSRGRPAVEARKQQVSLRLDPD
VIAKFKATGKGWQARVNEILKQAKI

Nucleotide

• Length: 318 bp