Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 117069..117649 | Replicon | chromosome |
Accession | NZ_CP119566 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PYR65_RS00610 | Protein ID | WP_276120923.1 |
Coordinates | 117069..117251 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicA | Uniprot ID | A0A0Q7NZ11 |
Locus tag | PYR65_RS00615 | Protein ID | WP_060638149.1 |
Coordinates | 117254..117649 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS00590 | 112393..112908 | + | 516 | WP_060501228.1 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA | - |
PYR65_RS00595 | 112955..114178 | + | 1224 | WP_276119500.1 | beta-ketoacyl-ACP synthase I | - |
PYR65_RS00600 | 114183..114989 | + | 807 | WP_060637916.1 | enoyl-ACP reductase FabI | - |
PYR65_RS00605 | 115091..116977 | + | 1887 | WP_276119501.1 | molecular chaperone HtpG | - |
PYR65_RS00610 | 117069..117251 | + | 183 | WP_276120923.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PYR65_RS00615 | 117254..117649 | + | 396 | WP_060638149.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PYR65_RS00620 | 117655..117894 | - | 240 | WP_060637914.1 | hypothetical protein | - |
PYR65_RS00625 | 118037..119053 | - | 1017 | WP_276119502.1 | class I SAM-dependent methyltransferase | - |
PYR65_RS00630 | 119217..121349 | - | 2133 | WP_060637912.1 | polyribonucleotide nucleotidyltransferase | - |
PYR65_RS00635 | 121715..121984 | - | 270 | WP_060637911.1 | 30S ribosomal protein S15 | - |
PYR65_RS00640 | 122163..122468 | - | 306 | WP_276119503.1 | SH3 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6586.80 Da Isoelectric Point: 11.2826
>T274193 WP_276120923.1 NZ_CP119566:117069-117251 [Pararhizobium sp. T808]
MERDSKAIIKRLKAEGFEIVSISGSHHKLRKGAKTIIVPHPKKDLPTGTARAIAKQAGWI
MERDSKAIIKRLKAEGFEIVSISGSHHKLRKGAKTIIVPHPKKDLPTGTARAIAKQAGWI
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14365.29 Da Isoelectric Point: 4.4001
>AT274193 WP_060638149.1 NZ_CP119566:117254-117649 [Pararhizobium sp. T808]
MKHFIALVHKDKDSAYGVTFPDLPGVFSAADEEEDLTANAVEAIRLWAEDQPVPVPSSHDEIMRLDDVSGELAAGAFLMR
VPFIEDSTRIVRANVTFEKGMLDAIDMAARERGLTRSAFLASCARKEIEAA
MKHFIALVHKDKDSAYGVTFPDLPGVFSAADEEEDLTANAVEAIRLWAEDQPVPVPSSHDEIMRLDDVSGELAAGAFLMR
VPFIEDSTRIVRANVTFEKGMLDAIDMAARERGLTRSAFLASCARKEIEAA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|