Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE(toxin)
Location 1965944..1966466 Replicon chromosome
Accession NZ_CP119563
Organism Rhodobacter capsulatus strain 37b4

Toxin (Protein)


Gene name relE Uniprot ID A0A1G7GZQ6
Locus tag PUH89_RS09560 Protein ID WP_074553261.1
Coordinates 1965944..1966228 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0N8VGB1
Locus tag PUH89_RS09565 Protein ID WP_055208226.1
Coordinates 1966218..1966466 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUH89_RS09515 (PUH89_09515) 1960982..1962202 + 1221 WP_074553259.1 cysteine desulfurase -
PUH89_RS09525 (PUH89_09525) 1962660..1963025 + 366 WP_276130977.1 SOS response-associated peptidase family protein -
PUH89_RS09530 (PUH89_09530) 1962920..1963240 + 321 WP_254771499.1 SOS response-associated peptidase family protein -
PUH89_RS09535 (PUH89_09535) 1963370..1963642 - 273 WP_139182402.1 hypothetical protein -
PUH89_RS09540 (PUH89_09540) 1963759..1964322 - 564 WP_055208219.1 Panacea domain-containing protein -
PUH89_RS09545 (PUH89_09545) 1964271..1964909 - 639 WP_139182403.1 hypothetical protein -
PUH89_RS09550 (PUH89_09550) 1965038..1965610 - 573 WP_254771500.1 hypothetical protein -
PUH89_RS09555 (PUH89_09555) 1965794..1965931 - 138 WP_160320005.1 hypothetical protein -
PUH89_RS09560 (PUH89_09560) 1965944..1966228 - 285 WP_074553261.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUH89_RS09565 (PUH89_09565) 1966218..1966466 - 249 WP_055208226.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUH89_RS09570 (PUH89_09570) 1966655..1967101 - 447 WP_074553262.1 hypothetical protein -
PUH89_RS09575 (PUH89_09575) 1967098..1967589 - 492 WP_074553263.1 hypothetical protein -
PUH89_RS09580 (PUH89_09580) 1967582..1967806 - 225 WP_139182404.1 hypothetical protein -
PUH89_RS09585 (PUH89_09585) 1968085..1968834 - 750 WP_139182405.1 hypothetical protein -
PUH89_RS09590 (PUH89_09590) 1968888..1969130 - 243 WP_055208237.1 hypothetical protein -
PUH89_RS09595 (PUH89_09595) 1969114..1969302 - 189 WP_074553266.1 hypothetical protein -
PUH89_RS09600 (PUH89_09600) 1969673..1970194 - 522 WP_074553267.1 hypothetical protein -
PUH89_RS09605 (PUH89_09605) 1970194..1970697 - 504 WP_055208241.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10796.51 Da        Isoelectric Point: 11.0917

>T274192 WP_074553261.1 NZ_CP119563:c1966228-1965944 [Rhodobacter capsulatus]
MTYSLEFHESALKEWKALGASVREQFKKKLAERLENPHVPASRLHGAQNRYKIKLRASGHRLVYEVRDAQIVVAVIAVGK
RERNAVYRAAAKRQ

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8603.78 Da        Isoelectric Point: 4.2840

>AT274192 WP_055208226.1 NZ_CP119563:c1966466-1966218 [Rhodobacter capsulatus]
MANVIHAGVTASVTELKRDPMGTMAAGQGAAVAILNRNQPAFYCVPAAEYEAMVERLEDAELNALADARAGGPFVRVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1G7GZQ6

Antitoxin

Source ID Structure
AlphaFold DB A0A0N8VGB1

References