Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 917737..918387 | Replicon | chromosome |
Accession | NZ_CP119552 | ||
Organism | Providencia stuartii strain CAVP450 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | K8W3H1 |
Locus tag | P2E06_RS03910 | Protein ID | WP_004927064.1 |
Coordinates | 917737..917940 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | P2E06_RS03915 | Protein ID | WP_154635730.1 |
Coordinates | 918019..918387 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2E06_RS03885 (P2E06_03885) | 913617..913955 | + | 339 | WP_154622397.1 | P-II family nitrogen regulator | - |
P2E06_RS03890 (P2E06_03890) | 913966..915249 | + | 1284 | WP_276123014.1 | ammonium transporter AmtB | - |
P2E06_RS03895 (P2E06_03895) | 915477..916343 | - | 867 | WP_276123015.1 | acyl-CoA thioesterase II | - |
P2E06_RS03900 (P2E06_03900) | 916668..917126 | + | 459 | WP_196713815.1 | YbaY family lipoprotein | - |
P2E06_RS03910 (P2E06_03910) | 917737..917940 | - | 204 | WP_004927064.1 | HHA domain-containing protein | Toxin |
P2E06_RS03915 (P2E06_03915) | 918019..918387 | - | 369 | WP_154635730.1 | Hha toxicity modulator TomB | Antitoxin |
P2E06_RS03920 (P2E06_03920) | 918955..920292 | - | 1338 | WP_154624041.1 | murein transglycosylase D | - |
P2E06_RS03925 (P2E06_03925) | 920371..921126 | - | 756 | WP_154624042.1 | hydroxyacylglutathione hydrolase | - |
P2E06_RS03930 (P2E06_03930) | 921166..921891 | + | 726 | WP_154624043.1 | methyltransferase domain-containing protein | - |
P2E06_RS03935 (P2E06_03935) | 921958..922428 | - | 471 | WP_154624044.1 | ribonuclease HI | - |
P2E06_RS03940 (P2E06_03940) | 922483..923244 | + | 762 | WP_154624045.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8075.37 Da Isoelectric Point: 6.9770
>T274188 WP_004927064.1 NZ_CP119552:c917940-917737 [Providencia stuartii]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14106.92 Da Isoelectric Point: 4.3486
>AT274188 WP_154635730.1 NZ_CP119552:c918387-918019 [Providencia stuartii]
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|