Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1536156..1536813 | Replicon | chromosome |
| Accession | NZ_CP119546 | ||
| Organism | Providencia stuartii strain CAVP490 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | P2E05_RS06590 | Protein ID | WP_163860914.1 |
| Coordinates | 1536403..1536813 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | P2E05_RS06585 | Protein ID | WP_154624313.1 |
| Coordinates | 1536156..1536422 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2E05_RS06570 (P2E05_06570) | 1531308..1534184 | + | 2877 | WP_163860913.1 | aminomethyl-transferring glycine dehydrogenase | - |
| P2E05_RS06575 (P2E05_06575) | 1534281..1534901 | - | 621 | WP_154624315.1 | HD domain-containing protein | - |
| P2E05_RS06580 (P2E05_06580) | 1534913..1535902 | - | 990 | WP_196713358.1 | tRNA-modifying protein YgfZ | - |
| P2E05_RS06585 (P2E05_06585) | 1536156..1536422 | + | 267 | WP_154624313.1 | FAD assembly factor SdhE | Antitoxin |
| P2E05_RS06590 (P2E05_06590) | 1536403..1536813 | + | 411 | WP_163860914.1 | protein YgfX | Toxin |
| P2E05_RS06595 (P2E05_06595) | 1536858..1537376 | - | 519 | WP_154624312.1 | flavodoxin FldB | - |
| P2E05_RS06600 (P2E05_06600) | 1537461..1538384 | + | 924 | WP_154624329.1 | site-specific tyrosine recombinase XerD | - |
| P2E05_RS06605 (P2E05_06605) | 1538404..1539105 | + | 702 | WP_154624311.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P2E05_RS06610 (P2E05_06610) | 1539115..1540848 | + | 1734 | WP_276123059.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15375.24 Da Isoelectric Point: 10.8779
>T274185 WP_163860914.1 NZ_CP119546:1536403-1536813 [Providencia stuartii]
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|