Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 613558..614183 | Replicon | chromosome |
Accession | NZ_CP119536 | ||
Organism | Agrobacterium fabrum strain 1D1487 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q7D0B1 |
Locus tag | P0252_RS03115 | Protein ID | WP_006311244.1 |
Coordinates | 613824..614183 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q7D0B2 |
Locus tag | P0252_RS03110 | Protein ID | WP_010971270.1 |
Coordinates | 613558..613824 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0252_RS03080 (P0252_03080) | 608732..609067 | - | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | - |
P0252_RS03085 (P0252_03085) | 609064..609339 | - | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
P0252_RS03090 (P0252_03090) | 609447..610055 | + | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
P0252_RS03095 (P0252_03095) | 610231..612816 | + | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
P0252_RS03100 (P0252_03100) | 612813..613235 | + | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
P0252_RS03105 (P0252_03105) | 613288..613488 | + | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
P0252_RS03110 (P0252_03110) | 613558..613824 | + | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P0252_RS03115 (P0252_03115) | 613824..614183 | + | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P0252_RS03120 (P0252_03120) | 614191..614439 | - | 249 | WP_006311245.1 | hypothetical protein | - |
P0252_RS03125 (P0252_03125) | 614618..616006 | + | 1389 | WP_169539085.1 | MFS transporter | - |
P0252_RS03130 (P0252_03130) | 616085..616258 | - | 174 | WP_010971273.1 | hypothetical protein | - |
P0252_RS03135 (P0252_03135) | 616327..618045 | - | 1719 | WP_276131170.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12857.04 Da Isoelectric Point: 8.2782
>T274177 WP_006311244.1 NZ_CP119536:613824-614183 [Agrobacterium fabrum]
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|