Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4662979..4663532 | Replicon | chromosome |
Accession | NZ_CP119531 | ||
Organism | Raoultella electrica strain Rd210413 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | P2G42_RS22300 | Protein ID | WP_285237531.1 |
Coordinates | 4662979..4663293 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | P2G42_RS22305 | Protein ID | WP_100683473.1 |
Coordinates | 4663296..4663532 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2G42_RS22275 (P2G42_22280) | 4658501..4659199 | - | 699 | WP_285237526.1 | hypothetical protein | - |
P2G42_RS22280 (P2G42_22285) | 4659264..4659755 | - | 492 | WP_285237527.1 | GNAT family N-acetyltransferase | - |
P2G42_RS22285 (P2G42_22290) | 4659752..4660045 | - | 294 | WP_285237528.1 | DUF1778 domain-containing protein | - |
P2G42_RS22290 (P2G42_22295) | 4660519..4661430 | - | 912 | WP_285237529.1 | LysR family transcriptional regulator | - |
P2G42_RS22295 (P2G42_22300) | 4661531..4662529 | + | 999 | WP_285237530.1 | aldo/keto reductase | - |
P2G42_RS22300 (P2G42_22305) | 4662979..4663293 | - | 315 | WP_285237531.1 | CcdB family protein | Toxin |
P2G42_RS22305 (P2G42_22310) | 4663296..4663532 | - | 237 | WP_100683473.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
P2G42_RS22310 (P2G42_22315) | 4663712..4663877 | + | 166 | Protein_4354 | transposase | - |
P2G42_RS22315 (P2G42_22320) | 4664095..4665243 | - | 1149 | WP_285237532.1 | MFS transporter | - |
P2G42_RS22320 (P2G42_22325) | 4665294..4666196 | - | 903 | WP_160704445.1 | DMT family transporter | - |
P2G42_RS22325 (P2G42_22330) | 4666467..4667501 | + | 1035 | WP_227699466.1 | iron-containing redox enzyme family protein | - |
P2G42_RS22330 (P2G42_22335) | 4667502..4668080 | - | 579 | WP_141963425.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11512.36 Da Isoelectric Point: 6.4489
>T274174 WP_285237531.1 NZ_CP119531:c4663293-4662979 [Raoultella electrica]
MQFTVYANTGKSTVYPLLLDVTNDIIGQLNRRIVIPLLPVDRYPAGHRPDRLVPFVSLTDGREYAVMTHELASIPVQALG
AVFCDAAQYRPQVKAAIDFLIDGI
MQFTVYANTGKSTVYPLLLDVTNDIIGQLNRRIVIPLLPVDRYPAGHRPDRLVPFVSLTDGREYAVMTHELASIPVQALG
AVFCDAAQYRPQVKAAIDFLIDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|