Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4659264..4660045 | Replicon | chromosome |
Accession | NZ_CP119531 | ||
Organism | Raoultella electrica strain Rd210413 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | P2G42_RS22280 | Protein ID | WP_285237527.1 |
Coordinates | 4659264..4659755 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | P2G42_RS22285 | Protein ID | WP_285237528.1 |
Coordinates | 4659752..4660045 (-) | Length | 98 a.a. |
Genomic Context
Location: 4654800..4656710 (1911 bp)
Type: Others
Protein ID: WP_285237524.1
Type: Others
Protein ID: WP_285237524.1
Location: 4656707..4658407 (1701 bp)
Type: Others
Protein ID: WP_285237525.1
Type: Others
Protein ID: WP_285237525.1
Location: 4661531..4662529 (999 bp)
Type: Others
Protein ID: WP_285237530.1
Type: Others
Protein ID: WP_285237530.1
Location: 4663712..4663877 (166 bp)
Type: Others
Protein ID: Protein_4354
Type: Others
Protein ID: Protein_4354
Location: 4658501..4659199 (699 bp)
Type: Others
Protein ID: WP_285237526.1
Type: Others
Protein ID: WP_285237526.1
Location: 4659264..4659755 (492 bp)
Type: Toxin
Protein ID: WP_285237527.1
Type: Toxin
Protein ID: WP_285237527.1
Location: 4659752..4660045 (294 bp)
Type: Antitoxin
Protein ID: WP_285237528.1
Type: Antitoxin
Protein ID: WP_285237528.1
Location: 4660519..4661430 (912 bp)
Type: Others
Protein ID: WP_285237529.1
Type: Others
Protein ID: WP_285237529.1
Location: 4662979..4663293 (315 bp)
Type: Others
Protein ID: WP_285237531.1
Type: Others
Protein ID: WP_285237531.1
Location: 4663296..4663532 (237 bp)
Type: Others
Protein ID: WP_100683473.1
Type: Others
Protein ID: WP_100683473.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2G42_RS22265 (P2G42_22270) | 4654800..4656710 | + | 1911 | WP_285237524.1 | hypothetical protein | - |
P2G42_RS22270 (P2G42_22275) | 4656707..4658407 | + | 1701 | WP_285237525.1 | hypothetical protein | - |
P2G42_RS22275 (P2G42_22280) | 4658501..4659199 | - | 699 | WP_285237526.1 | hypothetical protein | - |
P2G42_RS22280 (P2G42_22285) | 4659264..4659755 | - | 492 | WP_285237527.1 | GNAT family N-acetyltransferase | Toxin |
P2G42_RS22285 (P2G42_22290) | 4659752..4660045 | - | 294 | WP_285237528.1 | DUF1778 domain-containing protein | Antitoxin |
P2G42_RS22290 (P2G42_22295) | 4660519..4661430 | - | 912 | WP_285237529.1 | LysR family transcriptional regulator | - |
P2G42_RS22295 (P2G42_22300) | 4661531..4662529 | + | 999 | WP_285237530.1 | aldo/keto reductase | - |
P2G42_RS22300 (P2G42_22305) | 4662979..4663293 | - | 315 | WP_285237531.1 | CcdB family protein | - |
P2G42_RS22305 (P2G42_22310) | 4663296..4663532 | - | 237 | WP_100683473.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
P2G42_RS22310 (P2G42_22315) | 4663712..4663877 | + | 166 | Protein_4354 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17757.64 Da Isoelectric Point: 6.8438
>T274173 WP_285237527.1 NZ_CP119531:c4659755-4659264 [Raoultella electrica]
MISAPEPLHAGHILASFCCGVDSMDNWLKQRSMKNQATGASRTFVCCDSDLKVMAYYSLASSAVTMNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDDAREFYQRVGFEPSPMDPMMLMVTLGDLM
ESI
MISAPEPLHAGHILASFCCGVDSMDNWLKQRSMKNQATGASRTFVCCDSDLKVMAYYSLASSAVTMNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDDAREFYQRVGFEPSPMDPMMLMVTLGDLM
ESI
Download Length: 492 bp