Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4579553..4580210 | Replicon | chromosome |
| Accession | NZ_CP119531 | ||
| Organism | Raoultella electrica strain Rd210413 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | P2G42_RS21890 | Protein ID | WP_100684294.1 |
| Coordinates | 4579553..4579963 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A514ELX1 |
| Locus tag | P2G42_RS21895 | Protein ID | WP_004867358.1 |
| Coordinates | 4579944..4580210 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2G42_RS21870 (P2G42_21870) | 4575477..4577210 | - | 1734 | WP_285237506.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| P2G42_RS21875 (P2G42_21875) | 4577216..4577929 | - | 714 | WP_160703246.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P2G42_RS21880 (P2G42_21880) | 4577952..4578848 | - | 897 | WP_285237507.1 | site-specific tyrosine recombinase XerD | - |
| P2G42_RS21885 (P2G42_21885) | 4579026..4579547 | + | 522 | WP_131048606.1 | flavodoxin FldB | - |
| P2G42_RS21890 (P2G42_21890) | 4579553..4579963 | - | 411 | WP_100684294.1 | protein YgfX | Toxin |
| P2G42_RS21895 (P2G42_21895) | 4579944..4580210 | - | 267 | WP_004867358.1 | FAD assembly factor SdhE | Antitoxin |
| P2G42_RS21900 (P2G42_21900) | 4580507..4581490 | + | 984 | WP_160703248.1 | tRNA-modifying protein YgfZ | - |
| P2G42_RS21905 (P2G42_21905) | 4581606..4582265 | - | 660 | WP_131048604.1 | hemolysin III family protein | - |
| P2G42_RS21910 (P2G42_21910) | 4582427..4582738 | - | 312 | WP_131048603.1 | N(4)-acetylcytidine aminohydrolase | - |
| P2G42_RS21915 (P2G42_21915) | 4582788..4583516 | + | 729 | WP_131048725.1 | MurR/RpiR family transcriptional regulator | - |
| P2G42_RS21920 (P2G42_21920) | 4583636..4585069 | + | 1434 | WP_285237508.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16212.09 Da Isoelectric Point: 11.5202
>T274172 WP_100684294.1 NZ_CP119531:c4579963-4579553 [Raoultella electrica]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWVAADSMDAREWRDLRRLVLQKPAQD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWVAADSMDAREWRDLRRLVLQKPAQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|